KEGG   Sinorhizobium fredii NGR234: NGR_b13930Help
Entry
NGR_b13930        CDS       T00888                                 

Gene name
manB
Definition
(RefSeq) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00010  Glycolysis / Gluconeogenesis
rhi00030  Pentose phosphate pathway
rhi00051  Fructose and mannose metabolism
rhi00052  Galactose metabolism
rhi00230  Purine metabolism
rhi00500  Starch and sucrose metabolism
rhi00520  Amino sugar and nucleotide sugar metabolism
rhi00521  Streptomycin biosynthesis
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_b13930 (manB)
   00030 Pentose phosphate pathway
    NGR_b13930 (manB)
   00051 Fructose and mannose metabolism
    NGR_b13930 (manB)
   00052 Galactose metabolism
    NGR_b13930 (manB)
   00500 Starch and sucrose metabolism
    NGR_b13930 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    NGR_b13930 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    NGR_b13930 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NGR_b13930 (manB)
Enzymes [BR:rhi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NGR_b13930 (manB)
    5.4.2.8  phosphomannomutase
     NGR_b13930 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 7787941
NCBI-ProteinID: YP_002823597
RhizoBase: NGR_b13930
UniProt: C3KRY6
Position
pNGR234b:1396165..1397721
Genome map
AA seq 518 aa AA seqDB search
MAQVEFARIDPGSSYEPLHESGPDRFTLETSALIRPTGFREYDARWWFGRPDDGKAPDLN
LMGVQALGMGLGTFMRRSGAGPEIVTGHDFRSYSLGIKLALVSGLLAAGARVRDIGLALS
PMAYFAQFALDVPSVAMVTASHNENGWTGVKMGTARPLTFGPDEMAELKRIVLEADFDLT
GGGAYEFIADFRQRYIDDLTRDRRIARKLKVVVACGNGTAGAFAPHVLERIGCEVIPLDC
ELDHSFPHYNPNPEDLAMLHAIRDKVLESGADVGLGFDGDGDRCGVVDNEGREIFADKIG
VMLARDLSALHPNSVFVVDVKSTGLFASDPVLKASGAHTDYWKTGHSYIKRRVAELGALA
GFEKSGHFFFNPPLGRGYDDGLITALAVCEMLDRNPGMSMAELYRSLPVTWGSPTMSPHC
DDEVKYAVVERVVERFRTMQRDGLPVAGQQIANLVTVNGVRVVVEDGTWGLVRASSNKPE
LVVVVESPVSEARQRAMFAAVDGVLREHAEVGAYNQTI
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggtggagtttgctcgtattgacccaggctcgtcttacgagccgctacacgaa
tccggaccggaccggtttacccttgaaacgagtgctttgataaggccgacagggtttcgg
gagtatgacgcgcgatggtggttcggtcgcccggatgacgggaaggcgccggatttgaac
ctgatgggcgtgcaggctctgggcatggggctcggcaccttcatgcggcgctcgggcgcc
ggcccggagattgtaacgggacatgatttccgttcctattcgctgggcatcaagctcgcc
ttggtcagcgggctattggctgcgggcgcgcgggtccgcgacattggcctggcactgtcg
ccgatggcctatttcgcgcagttcgcgctcgacgtgccgtcggtagcgatggtgaccgcc
tcgcacaacgagaacggttggaccggcgtcaaaatgggcacggctcggccgctgaccttc
ggacccgacgagatggcggagctgaaaaggattgtgctggaggccgacttcgacctgacc
ggtggcggcgcctatgaattcatcgcggacttccggcagcgctatatcgacgatctcacc
cgcgacaggcgcatcgcccgcaagctgaaggtcgttgtggcctgcggaaacggcacggcc
ggcgcctttgcaccgcatgtgctggagaggatcggctgcgaggtgattccgctcgactgc
gagctcgaccattcgttcccacattataatcccaatcccgaggacctggcgatgctccat
gccatcagggacaaggtgctggaaagcggcgccgatgtcggcttgggtttcgacggcgac
ggcgaccgctgcggggtggtcgacaacgaaggccgtgagattttcgccgacaagatcggc
gtgatgctggcacgggatctctccgctttgcatcccaactcggtgttcgtcgtcgacgtg
aaatcgaccggtctgttcgcctcagatccggtgcttaaggcaagcggcgcccacacggac
tactggaagacgggccattcctatatcaagcgcagagtcgcggaactcggcgcgctggcg
ggcttcgaaaagtcggggcactttttcttcaacccgcctctcgggcgcggctatgacgac
gggctgatcaccgcgctcgcggtctgcgagatgctcgaccgcaatccaggcatgagcatg
gctgagctctaccggtcgctgccggtgacctggggctcgccgaccatgtcgccgcattgc
gacgatgaagtgaaatatgccgtggtcgagcgtgtggtggagcggttcaggacgatgcag
cgcgacgggctgccggtcgcgggccagcagatcgccaacctcgtcaccgttaacggcgtc
cgcgtggtggtcgaggacggcacctggggactggtgcgggcctcctccaacaagccggag
cttgtcgtcgtggtggaaagcccggtctcggaagcgcgccaacgcgccatgttcgcggca
gtcgacggcgtgctcagggagcatgcggaggtcggtgcctacaatcagaccatctag

DBGET integrated database retrieval system