KEGG   Sinorhizobium fredii NGR234: NGR_b15380Help
Entry
NGR_b15380        CDS       T00888                                 

Gene name
celC
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NGR_b15380 (celC)
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     NGR_b15380 (celC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pNGR234b:1550212..1551255
Genome map
AA seq 347 aa AA seqDB search
MRHLLIFALLLTVLVGPAEADERQASVKADAWAEYKSKFLDSSGRILDDANGNISHSEGQ
GYGLLLSFLANEPADFEQIWSFTRRELLLRDDGLAAWKWSPDDDPHVTDINNATDGDILI
AYSLTLAAERWSRNDYSQAAVSIAEAILDKTVVKHGGRTLLLPGVAGFAAADRADGPVIN
PSYWVFEALPVLDRLVPSPTWQALETDGKAMIQAMKFGPEDMPADWVSAKTSLKPASGFP
REFGFNALRIPLYLMRAEQADREFLLRLQRGMSGPHGELLTRDLETGAVRATLTDPGYRF
VNHILACVLEGTKVPENAKAFRPTQYYPSTLHLLGLTFVEEKHPECL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagacacctcttgatattcgcgcttcttctgacggtactggtcggaccggcggaggcg
gatgagaggcaggcaagcgtgaaggccgacgcctgggctgaatacaagtcgaagtttctc
gattcgagcgggcgtatcctcgacgacgccaatgggaacatcagccacagcgagggacag
ggttacggcctgctcctctcgttcctggcgaacgaacctgccgacttcgagcagatctgg
tccttcacccgccgcgagcttctgttgcgcgacgacgggcttgcagcctggaaatggagt
ccggacgacgatccccatgtgaccgacatcaacaacgcgaccgacggcgatattctgatc
gcgtatagcctgacactcgccgccgaacgctggagccggaacgactattcacaggcggcg
gtctcgatcgccgaggcaattctcgacaagaccgtcgtcaagcatggcggacgcacgctg
ctgctgcccggtgtcgcgggctttgccgccgccgatcgcgccgacggacccgtcatcaac
ccttcctattgggtcttcgaagccctgccggtgctcgaccgtctcgttccgtcgccgaca
tggcaggctctcgaaacggacggcaaggcgatgatccaggcaatgaaattcggcccggaa
gacatgccggccgattgggtgagcgccaagacgtcgctcaaaccggcctccggatttcca
cgggaattcggtttcaacgccctgcgcattccgctttacctcatgcgcgcagaacaagca
gaccgggagtttctgctgaggctgcaacgtgggatgtcgggaccgcatggcgagctcctg
acccgcgatctcgagaccggcgcggtgcgcgcgacgcttacggaccccggttatcggttt
gttaaccatattctggcctgtgttctcgaaggcaccaaggttccagagaacgccaaggcg
ttccgcccgacgcaatactacccatcgaccctgcacctgctgggactgactttcgtggag
gaaaagcatccggagtgtttatga

DBGET integrated database retrieval system