KEGG   Sinorhizobium fredii NGR234: NGR_b17390Help
Entry
NGR_b17390        CDS       T00888                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NGR_b17390 (tpiA)
   01230 Biosynthesis of amino acids
    NGR_b17390 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_b17390 (tpiA)
   00051 Fructose and mannose metabolism
    NGR_b17390 (tpiA)
   00562 Inositol phosphate metabolism
    NGR_b17390 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NGR_b17390 (tpiA)
Enzymes [BR:rhi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NGR_b17390 (tpiA)
Exosome [BR:rhi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NGR_b17390 (tpiA)
  Exosomal proteins of bladder cancer cells
   NGR_b17390 (tpiA)
  Exosomal proteins of melanoma cells
   NGR_b17390 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pNGR234b:complement(1771956..1772723)
Genome map
AA seq 255 aa AA seqDB search
MSKSRLWVGTSWKMNKTLSEAIAFADGLAAADAKRDDRIQRFVIPPFTVVREMKERLKET
SVKIGAQNMHWEDAGAWTGEISPLMLKDCGLDLVELGHSERREHFGETDRSVGLKTAAAV
RHGLVPLICIGETLAEREAGEADAVLKRQVEGAFALLDGAAKQAPILLAYEPVWAIGVNG
IPATADYADARHQRIAEVAEAALGVAVPVLYGGSVNPGNCEELIAQPHVDGLFIGRSAWE
VDGYLDILERVAGTI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtcgcggctctgggtcggtaccagctggaagatgaacaagacgctctcggag
gcgatcgccttcgccgatgggcttgcggccgccgatgcgaagcgtgacgaccgcatccag
cgtttcgtcattccgccgttcacagtggtccgcgagatgaaggagagactgaaggagacg
agcgtcaagatcggcgcacagaacatgcattgggaggatgccggcgcctggaccggcgaa
atctcccccctgatgctgaaggattgcgggctcgatcttgtcgaactcggtcacagcgag
cggcgcgaacattttggcgagaccgatcgcagcgtcggtctcaagacggcggcggccgtc
aggcatggcctcgttccgttgatctgcattggcgagacgctcgccgaacgggaggcgggc
gaggccgatgcggtgttgaagcgtcaggtggaaggggcgttcgcgctcctcgatggcgcc
gcgaaacaggcgccgatcctgctcgcctacgagcccgtctgggcgatcggcgtcaacggc
ataccggcgaccgccgattacgccgatgcccgccaccagcggattgccgaggtggccgag
gcggcgctcggcgtcgccgtgccggtgctctacggaggcagcgtcaatcctggaaactgc
gaggaactgatcgcgcagccccatgtcgacggcctcttcatcggccgttctgcctgggag
gtcgacggctacctcgacattctggagcgggtcgccggcacgatctga

DBGET integrated database retrieval system