KEGG   Sinorhizobium fredii NGR234: NGR_b18390Help
Entry
NGR_b18390        CDS       T00888                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00040  Pentose and glucuronate interconversions
rhi00052  Galactose metabolism
rhi00500  Starch and sucrose metabolism
rhi00520  Amino sugar and nucleotide sugar metabolism
rhi01100  Metabolic pathways
rhi01130  Biosynthesis of antibiotics
Module
rhi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NGR_b18390
   00052 Galactose metabolism
    NGR_b18390
   00500 Starch and sucrose metabolism
    NGR_b18390
   00520 Amino sugar and nucleotide sugar metabolism
    NGR_b18390
Enzymes [BR:rhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NGR_b18390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 7789162
NCBI-ProteinID: YP_002824041
RhizoBase: NGR_b18390
UniProt: Q6W2I5
Position
pNGR234b:1875644..1876549
Genome map
AA seq 301 aa AA seqDB search
MDRIRTVRKAVIPVAGNGTRFLPATKAVPKEMLTIVDRPVVQYAVDEARQAGIEHIVFVT
SRNKQVIEDHFDDTPELISSLSRSGKNAQISELEAMLPKAGSVSFTRQQAPLGLGHAVWC
ARDLIGDEPFALLLPDMVSYGARGCMAGLMDLYREVGGNVVAVEQCAPEEASKYGIVGKG
DTVRHGFSVTEMVEKPPAGQAPSNFYLNGRYILQPEIFSILAHQARGAGNEIQLTDGMLN
LSADQPFHAHPYEGRTFDCGSKQGFIEANVAFALARADIGDVVFESVREIVLSHESRIRA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcatcaggaccgtcaggaaagcagtgattccggtcgcaggaaacggaacgagg
ttcctccccgcgacgaaggctgtgccgaaggaaatgttgacgatcgtcgatcggcccgtc
gtccaatacgcggtcgatgaggcgcgtcaggccggcatcgagcacatcgtcttcgtcacc
agccgcaacaagcaggtgatcgaggatcatttcgacgacacgcccgaactcatctcctcg
ctgtcgcgttccggcaagaatgcgcagatctccgaactcgaagccatgctgccgaaggcc
ggttcggtcagcttcacgcgccagcaggcgccgctcggcctcggccacgcggtgtggtgc
gcgcgcgacctgatcggcgacgagcccttcgcgctgctgctgccggacatggtctcctac
ggcgcgcgcggctgcatggccgggctgatggacctttaccgcgaggttggcggcaatgtc
gtcgcggtcgagcaatgcgcgcccgaggaagcttcgaaatacggcatcgtcggcaagggc
gacacggtgcgccacggcttctcggtgaccgagatggtcgagaagccgccggcgggccag
gcgccgtccaacttctatctcaacggccgctatatcctgcaaccggagatcttctccatt
ctggcacaccaggcacgcggtgccggcaacgagatccagctgaccgacggcatgctgaac
ctttcggcggaccagcccttccatgcccatccctatgaaggccgtaccttcgattgcggc
tcgaagcagggcttcatcgaggccaatgtcgcctttgcactcgcccgcgcggatatcggc
gacgtcgtgttcgaatccgttcgcgagatcgtcctgtctcacgaaagccgcatccgggcg
gcataa

DBGET integrated database retrieval system