KEGG   Sinorhizobium fredii NGR234: NGR_b19210Help
Entry
NGR_b19210        CDS       T00888                                 

Definition
(RefSeq) asparagine synthetase AsnB
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00250  Alanine, aspartate and glutamate metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NGR_b19210
Enzymes [BR:rhi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NGR_b19210
Peptidases [BR:rhi01002]
 Cysteine Peptidases
  Family C44
   NGR_b19210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF1933 DUF3700
Motif
Other DBs
NCBI-GeneID: 7789243
NCBI-ProteinID: YP_002824121
RhizoBase: NGR_b19210
UniProt: C3KLT2
Position
pNGR234b:complement(1958402..1960414)
Genome map
AA seq 670 aa AA seqDB search
MQVNACSAHSGYTFSAVAGRESDFHMCGFGGYFGSIRDGRALLESMTAAIAHRGPDGQGI
FTVPEAGLGHVRLSIVGLGDGQQPMPDASGELTIAFNGEIFNYVELRDELRAKGRRFRTA
SDTEVILHLYDEMGEDCVSLLNGDFAFAIWDARRCRMMLARDRMGVRPLFYTAQGGTFYF
ASEVKALLQVPGVSAEIDPIALDQIFTLWAPIAPRTPFRNILELEPANVMIVDQRGVTTR
PYWQLQYPDRDQPSGYTHEGSAAEELRALLADATRIRMRADVPVGAYLSGGLDSSIVSAL
AAGMTPQGLRTFSVTFDSAEHDESAFQLEMAAALGTQHSAIACRAGDIAKVFPDVIRFTE
RPIIRTAPAPLYQLSGLVREAGLKVVLTGEGADEVFAGYDIFKEARVRRFCGRQPGSSIR
PHLFRKLYPYLPGLKQQSPEYLAAFFGAGDAPLDDPLFSHRPRLKGTAATKLFFSGDLRA
ELKDYDAAAELIGRLPQDFRRWHPLHQAQYLESRFLLPGYILSSQGDRMAMAHGIEGRFP
FLDHRLVEFAAKLPPEMKLKGLTEKHILREATKDLLPPAIGRRVKQPYRAPDSHSFTGPG
ELDYVRGALSEDAVAEGGLFNAKAVTKLYEKCRSRPASGFRDNAAFVGILSTQLWLQTFA
GTRIRKAEAA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagttaacgcttgctctgcccattcaggctatacgttcagcgcggttgcggggcgt
gagagcgattttcatatgtgtggttttggcggctattttggctcgatacgggacggaagg
gcgcttctcgaaagcatgacggccgcgattgcgcatcggggcccggacggacagggcatt
ttcaccgtgcccgaggccgggcttggtcatgtgcggctctccatcgtcgggctcggcgac
ggccagcagccgatgccggatgcgagtggcgaactgacgatcgccttcaacggcgaaatc
ttcaactatgtggaactccgggacgagcttcgcgccaagggccgccgcttccgcactgcg
agcgacaccgaggtcatcctccacctctatgacgagatgggcgaggattgcgtttcgctg
ctcaacggcgattttgccttcgcgatctgggatgcccggcgctgccggatgatgctggcg
cgcgaccggatgggggtgcgcccgcttttctataccgcgcagggcggcacgttctatttc
gcctccgaggtcaaggcgctccttcaggtgccgggcgtttcggcggagatcgacccgatc
gcgctcgaccagatctttaccctctgggcgccgatcgcgccccgcacgccgtttcgcaat
atcctcgagcttgaaccggccaatgtgatgatcgtcgaccagcgtggcgtcacgacgaga
ccctactggcagcttcaatacccggaccgggatcagccctcaggctacacacacgaagga
agtgccgccgaggaactgcgcgcccttttggcggacgcgacccgcatccgcatgcgggcc
gacgtgccggtcggcgcgtatctctccggcgggctcgattcgtcgatcgtctcggcgctg
gcggccggcatgacgccgcaggggcttcggaccttctcggttaccttcgacagcgccgaa
cacgacgaaagcgccttccagctggaaatggccgcagcactcggcacgcagcatagcgcg
atcgcctgccgcgccggcgacatcgccaaggtcttcccggatgtcatccgcttcaccgag
agaccgatcatccgcacggcgccagccccgctctaccaattgtccgggctggtgcgcgag
gccgggcttaaggtcgtgctgaccggcgaaggcgccgacgaggtcttcgcgggctacgac
atcttcaaggaagcgcgggtgcgccgtttctgcgggcgacagccgggctcgagcatccgg
ccgcatctcttccgcaagctctatccttatctcccgggtctcaagcagcagtcgccggaa
tatctcgccgccttcttcggcgccggcgacgcgccgctcgacgacccgctcttctcgcat
cggccgcgcctcaagggcaccgctgcgacgaaactgttcttttccggcgacctgcgcgct
gaactgaaggactacgatgccgctgcggagctcatcggccggctcccgcaggatttccgc
cgatggcatccgttgcatcaggcgcaatatctcgaaagccgtttcctgttgccgggctac
atcctctccagccagggcgaccggatggcgatggcccatgggatcgagggacgcttcccc
ttcctcgaccaccggctggtcgagtttgccgcgaagctgccgccggagatgaagctcaaa
ggccttaccgagaagcacatcctgcgcgaggcaacgaaggatcttctgccgcccgccatc
ggcaggcgggtgaagcagccctatcgcgcccccgacagccactctttcaccgggccgggt
gagctcgattacgtccgcggcgccctgagcgaggatgccgtggccgagggtggcctcttc
aatgccaaggcggtgacgaagctctacgagaaatgccgctcgcgtcccgcctcgggcttc
cgcgacaacgcggctttcgtcggcattctctcgacgcagctctggctgcagacatttgca
ggcacgcgcatccgcaaggcggaagcggcctga

DBGET integrated database retrieval system