KEGG   Sinorhizobium fredii NGR234: NGR_b19210Help
Entry
NGR_b19210        CDS       T00888                                 

Definition
asparagine synthetase AsnB
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rhi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pNGR234b:complement(1958402..1960414)
Genome map
AA seq 670 aa AA seqDB search
MQVNACSAHSGYTFSAVAGRESDFHMCGFGGYFGSIRDGRALLESMTAAIAHRGPDGQGI
FTVPEAGLGHVRLSIVGLGDGQQPMPDASGELTIAFNGEIFNYVELRDELRAKGRRFRTA
SDTEVILHLYDEMGEDCVSLLNGDFAFAIWDARRCRMMLARDRMGVRPLFYTAQGGTFYF
ASEVKALLQVPGVSAEIDPIALDQIFTLWAPIAPRTPFRNILELEPANVMIVDQRGVTTR
PYWQLQYPDRDQPSGYTHEGSAAEELRALLADATRIRMRADVPVGAYLSGGLDSSIVSAL
AAGMTPQGLRTFSVTFDSAEHDESAFQLEMAAALGTQHSAIACRAGDIAKVFPDVIRFTE
RPIIRTAPAPLYQLSGLVREAGLKVVLTGEGADEVFAGYDIFKEARVRRFCGRQPGSSIR
PHLFRKLYPYLPGLKQQSPEYLAAFFGAGDAPLDDPLFSHRPRLKGTAATKLFFSGDLRA
ELKDYDAAAELIGRLPQDFRRWHPLHQAQYLESRFLLPGYILSSQGDRMAMAHGIEGRFP
FLDHRLVEFAAKLPPEMKLKGLTEKHILREATKDLLPPAIGRRVKQPYRAPDSHSFTGPG
ELDYVRGALSEDAVAEGGLFNAKAVTKLYEKCRSRPASGFRDNAAFVGILSTQLWLQTFA
GTRIRKAEAA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagttaacgcttgctctgcccattcaggctatacgttcagcgcggttgcggggcgt
gagagcgattttcatatgtgtggttttggcggctattttggctcgatacgggacggaagg
gcgcttctcgaaagcatgacggccgcgattgcgcatcggggcccggacggacagggcatt
ttcaccgtgcccgaggccgggcttggtcatgtgcggctctccatcgtcgggctcggcgac
ggccagcagccgatgccggatgcgagtggcgaactgacgatcgccttcaacggcgaaatc
ttcaactatgtggaactccgggacgagcttcgcgccaagggccgccgcttccgcactgcg
agcgacaccgaggtcatcctccacctctatgacgagatgggcgaggattgcgtttcgctg
ctcaacggcgattttgccttcgcgatctgggatgcccggcgctgccggatgatgctggcg
cgcgaccggatgggggtgcgcccgcttttctataccgcgcagggcggcacgttctatttc
gcctccgaggtcaaggcgctccttcaggtgccgggcgtttcggcggagatcgacccgatc
gcgctcgaccagatctttaccctctgggcgccgatcgcgccccgcacgccgtttcgcaat
atcctcgagcttgaaccggccaatgtgatgatcgtcgaccagcgtggcgtcacgacgaga
ccctactggcagcttcaatacccggaccgggatcagccctcaggctacacacacgaagga
agtgccgccgaggaactgcgcgcccttttggcggacgcgacccgcatccgcatgcgggcc
gacgtgccggtcggcgcgtatctctccggcgggctcgattcgtcgatcgtctcggcgctg
gcggccggcatgacgccgcaggggcttcggaccttctcggttaccttcgacagcgccgaa
cacgacgaaagcgccttccagctggaaatggccgcagcactcggcacgcagcatagcgcg
atcgcctgccgcgccggcgacatcgccaaggtcttcccggatgtcatccgcttcaccgag
agaccgatcatccgcacggcgccagccccgctctaccaattgtccgggctggtgcgcgag
gccgggcttaaggtcgtgctgaccggcgaaggcgccgacgaggtcttcgcgggctacgac
atcttcaaggaagcgcgggtgcgccgtttctgcgggcgacagccgggctcgagcatccgg
ccgcatctcttccgcaagctctatccttatctcccgggtctcaagcagcagtcgccggaa
tatctcgccgccttcttcggcgccggcgacgcgccgctcgacgacccgctcttctcgcat
cggccgcgcctcaagggcaccgctgcgacgaaactgttcttttccggcgacctgcgcgct
gaactgaaggactacgatgccgctgcggagctcatcggccggctcccgcaggatttccgc
cgatggcatccgttgcatcaggcgcaatatctcgaaagccgtttcctgttgccgggctac
atcctctccagccagggcgaccggatggcgatggcccatgggatcgagggacgcttcccc
ttcctcgaccaccggctggtcgagtttgccgcgaagctgccgccggagatgaagctcaaa
ggccttaccgagaagcacatcctgcgcgaggcaacgaaggatcttctgccgcccgccatc
ggcaggcgggtgaagcagccctatcgcgcccccgacagccactctttcaccgggccgggt
gagctcgattacgtccgcggcgccctgagcgaggatgccgtggccgagggtggcctcttc
aatgccaaggcggtgacgaagctctacgagaaatgccgctcgcgtcccgcctcgggcttc
cgcgacaacgcggctttcgtcggcattctctcgacgcagctctggctgcagacatttgca
ggcacgcgcatccgcaaggcggaagcggcctga

DBGET integrated database retrieval system