KEGG   Sinorhizobium fredii NGR234: NGR_b19710Help
Entry
NGR_b19710        CDS       T00888                                 

Gene name
acoC1
Definition
branched-chain alpha-keto acid dehydrogenase E2 subunit (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NGR_b19710 (acoC1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_b19710 (acoC1)
   00020 Citrate cycle (TCA cycle)
    NGR_b19710 (acoC1)
   00620 Pyruvate metabolism
    NGR_b19710 (acoC1)
Enzymes [BR:rhi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NGR_b19710 (acoC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pNGR234b:complement(2017374..2018492)
Genome map
AA seq 372 aa AA seqDB search
MSSIEAVTVPKWGMTMTEGKITQWMVGEGGPVTRGQEILEIETTKVTNVVEAAATGTLRR
IVLNEGTTAPVGALAGVIADEAATPEEIDAFIASYADRLGSGDEGEGGASVPRTITVDGG
TVNVLEAGPESDETVVLLHGFGGDLSTWLFNQTALADKMRVVAVDLPGHGASSPIAGEDV
FLKIVAAVEAAVDAVAPGKLHLVAHSFGGAVAAAIATNRPSRVGSLTLIAPIGLSRQMSR
DFLVDFIAAERRRQLSSVLERLFADPSKITSDMVEGTLRFKRLEGVPEALSAIADTIADD
SGQVQSIGGQLKDLPCPVTILWGDRDEIVPLPQSTEVPANARLRIIPDVGHMPQMEASSA
VNDAILETFQRG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaatcgaggcagtcacggttcccaaatggggaatgacgatgaccgagggcaag
atcacccagtggatggtcggcgagggcggccctgtcacgcggggtcaggaaatcctcgag
atcgaaaccaccaaggtcaccaatgtcgtcgaagccgccgcgaccggaacgctgcgacgc
atcgtcctcaatgagggaacgacggcgccggtcggtgcgctggccggggtgatcgccgac
gaagcggccacaccggaggagatcgatgccttcatcgcgagctatgccgaccggcttggt
tcgggcgacgaaggcgagggcggcgcctccgtgccgcggacgatcacggtcgacggcggc
accgtcaacgtcctcgaagccgggccggagagcgacgagacggtggtgctcttgcacggc
tttggcggcgacctgtcgacctggctgttcaaccagacggcgcttgccgacaagatgcgg
gtggtggcggtcgatctgcccggacacggcgcctcgtcgccgatcgccggcgaggatgtc
tttttgaagatcgtcgctgccgttgaagcggcggtcgacgccgttgcccccggcaagctt
cacctcgtcgcgcattccttcggcggtgccgtcgcagcggcgatcgccaccaaccggccg
tcgcgcgtgggttcgctgacgctgatcgcgccgatcgggctgagccggcagatgagccgg
gatttccttgtcgacttcattgcggcggagcgccgccgtcagctgtcgagcgtgctggag
cggctatttgccgatccgtcgaagatcaccagcgacatggtcgaaggcacgcttcgcttc
aagcgcctcgagggcgtgccggaggcgctgtcggccatcgccgatacgatcgccgacgac
agcggccaggtgcagtcgatcggcggccagctcaaggacctgccgtgcccggtgacgatc
ctttggggcgaccgggacgagatcgtgccgctcccgcagtccaccgaggtgcccgccaac
gcgcggctgcgcatcatcccggacgtcggccacatgccgcagatggaggcatcgtccgcc
gtcaacgacgccatcctggagacattccagcgcgggtga

DBGET integrated database retrieval system