KEGG   Sinorhizobium fredii NGR234: NGR_b19880Help
Entry
NGR_b19880        CDS       T00888                                 

Gene name
acoC2
Definition
branched-chain alpha-keto acid dehydrogenase E2 subunit (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rhi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rhi00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rhi00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rhi00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pNGR234b:complement(2031990..2033108)
Genome map
AA seq 372 aa AA seqDB search
MSSIEAVTVPKWGMTMTEGKITQWMVGEGGPVTRGQEILEIETTKVTNVVEAAATGTLRR
IVLNEGTTAPVGALAGVIADEAATPEEIDAFIASYADRLGSGDEGEGGASVPRTITVDGG
TVNVLEAGPESDETVVLLHGFGGDLSTWLFNQSALAEKMRVVAVDLPGHGASSPIAGEDV
FLKIVAAVEAAVDAVAPGKLHLVAHSFGGAVAAAIATNRPSRVGSLTLIAPIGLSRQMSR
DFLVDFIAAERRRQLSSVLERLFADPSKITSDMVEGTLRFKRLEGVPEALSAIADTIADD
SGQVQSIGGQLKDLPCPVTILWGDRDEIVPLPQSTEVPANARLRIIPDVGHMPQMEASSA
VNDAILETFQRG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaatcgaggcagtcacggttcccaaatggggaatgacgatgaccgagggcaag
atcacccagtggatggtcggcgagggcggccctgtcacgcggggtcaggaaatcctcgag
atcgaaaccaccaaggtcaccaatgtcgtcgaagccgccgcgaccggaacgctgcgacgc
atcgtcctcaatgagggaacgacggcgccggtcggtgcgctggccggggtgatcgccgac
gaagcggccacaccggaggagatcgatgccttcatcgcgagctatgccgaccggcttggt
tcgggcgacgaaggcgagggcggcgcctccgtgccgcggacgatcacggtcgacggcggc
accgtcaacgtcctcgaagccgggccggagagcgacgagacggtggtgctcttgcacggc
tttggcggcgacctgtcgacctggctgttcaaccagtcggcgctcgccgagaagatgcgg
gtggtggcggtcgatctgcccggacacggcgcctcgtcgccgatcgccggcgaggatgtc
tttttgaagatcgtcgctgccgttgaagcggcggtcgacgccgttgcccccggcaagctt
cacctcgtcgcacactccttcggcggtgccgtcgcagcggcgatcgccaccaaccggccg
tcgcgcgtgggttcgctgacgctgatcgcgccgatcgggctgagccggcagatgagccgg
gatttccttgtcgacttcattgcggcggagcgccgccgtcagctgtcgagcgtgctggag
cggctatttgccgatccgtcgaagatcaccagcgacatggtcgaaggcacgcttcgcttc
aagcgcctcgagggcgtgccggaggcgctgtcggccatcgccgatacgatcgccgacgac
agcggccaggtgcagtcgatcggcggccagctcaaggacctgccgtgcccggtgacgatc
ctttggggcgaccgggacgagatcgtgccgctcccgcagtccaccgaggtgcccgccaac
gcgcggctgcgcatcatcccggacgtcggccacatgccgcagatggaggcatcgtccgcc
gtcaacgacgccatcctggagacattccagcgcgggtga

DBGET integrated database retrieval system