KEGG   Sinorhizobium fredii NGR234: NGR_c00540Help
Entry
NGR_c00540        CDS       T00888                                 

Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NGR_c00540
Enzymes [BR:rhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NGR_c00540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 7790633
NCBI-ProteinID: YP_002824611
RhizoBase: NGR_c00540
UniProt: C3MF21
Position
complement(57897..58796)
Genome map
AA seq 299 aa AA seqDB search
MITVFGSINMDLIATTARLPKPGETVAGTGFSTAAGGKGANQALAARRAGASVRMAGAVG
SDGFAAGALALLKEAGTDLGFTKTVNEPTGTAHILVGGDGENVIVVVASANATVSEGDAA
TAVEQMSAGDTLMLQLEIPAASVEKALVEAKRRGIRSVINIAPLTPEAARLGRMADIVIA
NETEFELLAGKSGIAGAEREAAMKRLHDETGQTVIVTLGAEGVAAAHGGEIHRAKGLTIE
PVDTVGAGDTFCGYLAASLDAGLSFPDALRRAAVAGSLACLKAGAQPSIPLASEVAARL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtttttgggtccatcaacatggacctgatcgccacgaccgcacgtctgccg
aagcccggcgagaccgtcgccggaaccggcttctcgactgccgccggcggcaagggtgcg
aaccaggcgctagcggcccgccgtgccggtgcttccgtccgcatggccggcgccgtcggc
tcggacggcttcgcggcaggcgctctcgcactgctcaaggaggccggcaccgacctcggc
ttcaccaagaccgtgaacgagccgaccggtaccgcgcatatccttgtcggcggcgacggc
gagaacgtcatcgtcgtcgtggcgagcgccaatgcgacggtgagcgagggcgatgccgcc
accgccgtcgagcaaatgtcagccggcgacacgttgatgctgcagctcgagattcccgcg
gcctcggtggaaaaggcgcttgtcgaggcaaagcgccgcggcatccgctcggtcatcaac
atcgcgccgctgacgcccgaggctgcccgcctcggccgcatggccgatatcgtcattgcc
aacgagaccgaattcgaactcctggccggcaagagcggcatcgccggcgccgaacgcgag
gcggcgatgaagcgccttcacgacgaaaccgggcagacggtgatcgtcacgctcggcgcc
gaaggggtcgccgcggctcacgggggcgaaatccatcgcgccaaggggctgaccatcgaa
ccggtcgatacggtcggggccggcgatacgttctgtggctatctcgccgcgagcctggac
gcgggcctctccttccccgatgcgctgcgccgcgccgcggtcgccgggtcgctcgcctgc
ctgaaagcgggagcgcaaccctccataccgctcgcctccgaggtcgccgcgcgtctttga

DBGET integrated database retrieval system