KEGG   Sinorhizobium fredii NGR234: NGR_c00610Help
Entry
NGR_c00610        CDS       T00888                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rhi01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rhi00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(63856..65049)
Genome map
AA seq 397 aa AA seqDB search
MFPTDPISNLAALIRCPSVTPAEGGALTALEAMLAPLGFSVDRVVAKEAGTPDIENLYAR
LGAEGPHLMFAGHTDVVPVGDEAAWSHPPFSAAIARGEMYGRGAVDMKGGIACFVAAVAR
HIEKHGRPKGSISFLITGDEEGPAINGTVKLLEWAAQKGERWDACLVGEPTNPESLGDMI
KIGRRGSLSGRITVHGVQGHAAYPHLADNPVRGILQLTQALMDSAFDAGTDTFQPSNLEV
TTIDVGNAAVNVIPARASAAFNIRFNDHWTAESLKAEIVARLDRAAKDETLRPGRQPVKY
DIVWNERPSHVFLTRNNALIDSLSGAVEAVTGRQPKLSTTGGTSDARFIKDYCPVVEFGL
VGQTMHMVDERVAIADLETLTGIYEAFVARWFGHAAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttccccaccgatccgatctccaatctcgctgccctcatccgttgcccctcggtcacc
ccggccgaaggcggtgcgcttaccgctctggaagcgatgctggcgccgctcgggttctcg
gtcgatcgggtcgtggcgaaggaggcaggcacgccggatatcgagaacctctatgcccgg
ctcggcgccgaaggaccgcatctgatgttcgctggccatacggatgtcgtgccggtcggc
gacgaagccgcctggtcccatccgccgttctctgccgcgatcgcccgcggcgaaatgtac
gggcgcggtgccgtcgacatgaagggcggcattgcctgcttcgtggcggctgtggcccgc
cacatcgagaagcatggccgcccgaagggctcgatctccttcctgatcaccggcgacgag
gaaggtccggcgatcaacggcacggtgaagctgctcgaatgggccgcccaaaaaggcgaa
cgctgggacgcctgccttgtcggcgagccgaccaatccggagagcctcggcgacatgatc
aagatcggccggcgcggctcgctgtccggccggatcaccgtgcatggcgtgcagggccac
gccgcctatccgcacctcgccgacaatccggtgcgcggcattctgcagctcacgcaagcc
ctgatggactcggccttcgacgctggcaccgacaccttccagccatccaatctggaggtc
acgacgatcgacgtcggcaatgccgccgtcaacgtcattccggccagggcgagcgccgcc
ttcaacatccgcttcaacgatcactggacggccgaaagcctgaaggcggagatcgtcgcg
cgtctcgaccgcgccgcgaaggacgaaacgctgcgtcccggtcggcagccggtcaagtac
gacatcgtctggaacgagcggccgagccacgtcttcctgacgcgcaacaatgcgttgatc
gattcgctttccggcgcagtcgaagccgtgaccgggcgccagccgaagctctccaccacc
ggcggcacgtcggacgcccgcttcatcaaggactattgcccggtggtcgaattcggcctc
gtcggccagacgatgcacatggtcgacgagcgtgtcgccatcgccgatctcgaaaccctg
accgggatctacgaagccttcgtcgcccgctggttcggccatgccgctgcttga

DBGET integrated database retrieval system