KEGG   Sinorhizobium fredii NGR234: NGR_c00610Help
Entry
NGR_c00610        CDS       T00888                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00300  Lysine biosynthesis
rhi01100  Metabolic pathways
rhi01120  Microbial metabolism in diverse environments
rhi01230  Biosynthesis of amino acids
Module
rhi_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NGR_c00610 (dapE)
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NGR_c00610 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 7790640
NCBI-ProteinID: YP_002824618
RhizoBase: NGR_c00610
UniProt: C3MF28
Position
complement(63856..65049)
Genome map
AA seq 397 aa AA seqDB search
MFPTDPISNLAALIRCPSVTPAEGGALTALEAMLAPLGFSVDRVVAKEAGTPDIENLYAR
LGAEGPHLMFAGHTDVVPVGDEAAWSHPPFSAAIARGEMYGRGAVDMKGGIACFVAAVAR
HIEKHGRPKGSISFLITGDEEGPAINGTVKLLEWAAQKGERWDACLVGEPTNPESLGDMI
KIGRRGSLSGRITVHGVQGHAAYPHLADNPVRGILQLTQALMDSAFDAGTDTFQPSNLEV
TTIDVGNAAVNVIPARASAAFNIRFNDHWTAESLKAEIVARLDRAAKDETLRPGRQPVKY
DIVWNERPSHVFLTRNNALIDSLSGAVEAVTGRQPKLSTTGGTSDARFIKDYCPVVEFGL
VGQTMHMVDERVAIADLETLTGIYEAFVARWFGHAAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttccccaccgatccgatctccaatctcgctgccctcatccgttgcccctcggtcacc
ccggccgaaggcggtgcgcttaccgctctggaagcgatgctggcgccgctcgggttctcg
gtcgatcgggtcgtggcgaaggaggcaggcacgccggatatcgagaacctctatgcccgg
ctcggcgccgaaggaccgcatctgatgttcgctggccatacggatgtcgtgccggtcggc
gacgaagccgcctggtcccatccgccgttctctgccgcgatcgcccgcggcgaaatgtac
gggcgcggtgccgtcgacatgaagggcggcattgcctgcttcgtggcggctgtggcccgc
cacatcgagaagcatggccgcccgaagggctcgatctccttcctgatcaccggcgacgag
gaaggtccggcgatcaacggcacggtgaagctgctcgaatgggccgcccaaaaaggcgaa
cgctgggacgcctgccttgtcggcgagccgaccaatccggagagcctcggcgacatgatc
aagatcggccggcgcggctcgctgtccggccggatcaccgtgcatggcgtgcagggccac
gccgcctatccgcacctcgccgacaatccggtgcgcggcattctgcagctcacgcaagcc
ctgatggactcggccttcgacgctggcaccgacaccttccagccatccaatctggaggtc
acgacgatcgacgtcggcaatgccgccgtcaacgtcattccggccagggcgagcgccgcc
ttcaacatccgcttcaacgatcactggacggccgaaagcctgaaggcggagatcgtcgcg
cgtctcgaccgcgccgcgaaggacgaaacgctgcgtcccggtcggcagccggtcaagtac
gacatcgtctggaacgagcggccgagccacgtcttcctgacgcgcaacaatgcgttgatc
gattcgctttccggcgcagtcgaagccgtgaccgggcgccagccgaagctctccaccacc
ggcggcacgtcggacgcccgcttcatcaaggactattgcccggtggtcgaattcggcctc
gtcggccagacgatgcacatggtcgacgagcgtgtcgccatcgccgatctcgaaaccctg
accgggatctacgaagccttcgtcgcccgctggttcggccatgccgctgcttga

DBGET integrated database retrieval system