KEGG   Sinorhizobium fredii NGR234: NGR_c01670Help
Entry
NGR_c01670        CDS       T00888                                 

Gene name
fadB
Definition
(RefSeq) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00071  Fatty acid degradation
rhi00280  Valine, leucine and isoleucine degradation
rhi00281  Geraniol degradation
rhi00310  Lysine degradation
rhi00362  Benzoate degradation
rhi00380  Tryptophan metabolism
rhi00410  beta-Alanine metabolism
rhi00640  Propanoate metabolism
rhi00650  Butanoate metabolism
rhi00903  Limonene and pinene degradation
rhi00930  Caprolactam degradation
rhi01040  Biosynthesis of unsaturated fatty acids
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01200  Carbon metabolism
rhi01212  Fatty acid metabolism
Module
rhi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NGR_c01670 (fadB)
   00650 Butanoate metabolism
    NGR_c01670 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    NGR_c01670 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    NGR_c01670 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NGR_c01670 (fadB)
   00310 Lysine degradation
    NGR_c01670 (fadB)
   00380 Tryptophan metabolism
    NGR_c01670 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NGR_c01670 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NGR_c01670 (fadB)
   00281 Geraniol degradation
    NGR_c01670 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NGR_c01670 (fadB)
   00930 Caprolactam degradation
    NGR_c01670 (fadB)
Enzymes [BR:rhi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     NGR_c01670 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NGR_c01670 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     NGR_c01670 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO FAD_binding_3 NAD_binding_2 2-Hacid_dh_C NAD_binding_8 UDPG_MGDP_dh_N NAD_binding_7 ApbA GIDA Pyr_redox
Motif
Other DBs
NCBI-GeneID: 7790745
NCBI-ProteinID: YP_002824720
RhizoBase: NGR_c01670
UniProt: C3MFR6
Position
complement(183977..186190)
Genome map
AA seq 737 aa AA seqDB search
MSYTNFKIETDADGIALVTWDMPDKSMNVFTEEVMDELDAIVDQTTADAAVKGVVFTSGK
SSFSGGADLSMIKSMFTLQAEERKKDPANAAQKLFNLVGRMTGLFRKLETSGKPWVSAIN
GTCMGGAFELSLACHGRVASNSKSVKIALPEVKVGIFPGAGGTQRVPRLTNTQDALQMMT
TGSSLTAARAKAMGLVHEVVEPEKLVEAAKAMIKNGLKAVQPWDEKGFKLPGGGVWTPAS
AQLWPAASGILRRETYGNYPGAIAILKCVYEGLQVPFDTGLKIEQRYFTEILQTTEAFSM
IRSLFVSMQELGKGARRPAGVPKTEFKTVGVVGAGFMGASIAYVTAAAGIPVTLIDRDME
ASEKGKAHSEGLVKDAIGKGRLTKEEGEALLSRITPSADYGDLKDAGLVVEAVFEDRQVK
KDVIEKVEAVIAPDAIFASNTSTLPITGLARNSKRPEQFIGVHFFSPVEKMMLTEVIVGK
ETGDKALATALDYVAAIKKTPIVVNDTRGFYVNRCVFRYIHEAYDMLIEGVPPAMIENAA
KMAGMPVGPLSLNDEVAIDLSQKILKATVADLGEKAVDPRHMELVNKMVDELDRRGRKNG
KGFYEYPAKPAKKYLWPGLKELYSQKPADKVDVEVVKQRFLATIALEAARTIEEGIVTDP
READVGSILGFGFAPYTGGTLSYIDGMGIKAFVAMCNKLAKAYGDHFEPTPLLKEMAEKG
ETFYGRFDPYGQAQKAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacacgaacttcaagatcgaaaccgacgcggacggcatcgcactcgtcacctgg
gacatgcccgacaagtcgatgaacgtcttcactgaggaggtgatggacgaactcgatgcg
atcgtcgaccagacgaccgccgatgccgccgtcaagggcgtcgtcttcacctccggcaag
tcgtccttctccggcggcgccgatctgtcgatgatcaagtcgatgttcacgttgcaggcc
gaggagaggaaaaaggatccggccaacgccgcgcagaagctcttcaatctcgtcggtcgc
atgaccgggctgttccgcaagctcgaaacctcaggcaagccgtgggtctcggcgatcaac
ggcacctgcatgggcggcgccttcgaactgtcgctcgcctgccacggccgcgtcgcttcc
aactcgaaatccgtgaagatcgccctccccgaggtcaaggtcggcatcttcccgggcgcc
ggcggcacccagcgcgtgccgcggctcaccaatacgcaggacgccctgcagatgatgacc
accggctcgtcgctgaccgcggcgcgcgccaaggcgatgggcctcgtgcacgaagtggtc
gagccggagaagctggtcgaagccgccaaggcgatgatcaagaacgggctcaaagccgtg
cagccctgggacgagaagggcttcaagcttccgggcggcggcgtctggacgcctgcctcc
gcgcagctctggccggcagcgtccggcattctgcgccgtgaaacctatggcaattatccg
ggcgccatcgccatcctgaaatgcgtctatgaaggtctgcaggtgccgttcgacaccggg
ctcaagatcgagcagcgctatttcaccgagatcctgcagaccaccgaagccttctctatg
atccgctcgctgttcgtctcgatgcaggagcttggcaagggcgcccgccgcccggccggc
gtcccgaaaacggagttcaagacggtcggcgtcgtcggcgccggcttcatgggcgcctcg
atcgcctacgtgacggccgccgccggcattcccgtcaccctcatcgaccgcgacatggaa
gcgtccgagaagggcaaggcgcattcggaggggctggtcaaggacgcgatcggcaagggg
cggctgaccaaggaagagggcgaggcgctgctttcgcgcatcacgccatcggccgactat
ggcgatctcaaggacgccggcctcgtcgtcgaggcggtgttcgaggaccggcaggtcaag
aaggacgtgatcgagaaggtcgaggcggtcatcgccccggacgccatcttcgcctccaac
acctcgacgctgccgatcaccggccttgccaggaattcgaagcggccggagcagttcatc
ggcgtccacttcttctcgccggtcgaaaagatgatgctgacggaagtgatcgtcggcaag
gagaccggcgacaaggcgctggccacggcgctcgactatgtcgcggcgatcaagaagacg
ccgatcgtcgtcaacgacacccgcggcttctacgtcaaccgctgcgtcttccgctatatc
cacgaagcctacgacatgctgatcgagggggtgccgccggcgatgatcgagaatgccgcc
aagatggccggcatgccggtcggaccgctgtcgctcaacgacgaggtggcgatcgacctc
agccagaagatcctcaaggcgacggtcgccgacctcggcgaaaaggccgtcgacccgcgc
cacatggaactggtcaacaagatggtcgacgaactcgaccggcgcggccgcaagaacggc
aagggcttctacgagtatccggcgaagccggccaagaaatatctgtggccggggctcaag
gagctctactcgcagaagccggcagacaaggtcgatgtcgaggtggtgaagcagcgcttc
ctggcgacgatcgcgttggaagcggcccgcaccatcgaggaaggcatcgtcaccgacccg
cgcgaggcggatgtcggctcgatcctcggcttcggcttcgcgccctacaccggcggcacg
ctctcctatatcgacggcatgggcatcaaagccttcgtcgcgatgtgcaacaaactagcc
aaggcttatggcgaccacttcgagccgacgccgctcttgaaggagatggccgaaaagggc
gagaccttctacggtcggttcgacccctacgggcaggcgcagaaggcggcttaa

DBGET integrated database retrieval system