KEGG   Sinorhizobium fredii NGR234: NGR_c02110Help
Entry
NGR_c02110        CDS       T00888                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:rhi00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
245078..245677
Genome map
AA seq 199 aa AA seqDB search
MAEDALIVIDMQNDFCPGGALAVAGGDEIVPVVNSLIEKAKHVILTQDWHPAGHSSFASS
HPGKAPFQTVTMPYGEQTLWPDHCVQGSPGADFHPALRWTTAELVIRKGFRTGIDSYSAF
FENDHRTPTGLAGYLRERGISKVSLCGLATDFCVAFSALDAVAEGFSTSVVLDACRGIDL
NGSLAAMTRRMRDAGVELI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagatgccctgatcgtcatcgacatgcagaacgatttctgcccgggcggagcg
cttgccgttgcgggcggcgacgaaatcgtgccggtcgtcaacagtttgatcgaaaaggcc
aagcacgtcatcctgacgcaggactggcacccggccgggcattcgagcttcgcgtcgagc
caccccggcaaggcgccctttcagacggtgacgatgccctatggcgaacagacgctctgg
cccgatcactgcgtccagggcagtccaggcgccgattttcatcccgctttgcgctggacg
acggcggagctggtcatccgcaaggggttccgcaccgggatcgacagctattccgccttc
ttcgaaaacgatcaccgcaccccgaccgggctggccggctacctgcgcgagcgcggcatc
tccaaagtgtcgctctgcggcctcgcgaccgatttctgcgtcgccttctcggcgctcgat
gcggttgcggagggattttcgacttccgtcgtgctcgacgcctgtcgcggcatcgatctg
aacggatcgcttgccgcgatgacccggcgcatgcgtgatgcgggcgttgaactgatctag

DBGET integrated database retrieval system