KEGG   Sinorhizobium fredii NGR234: NGR_c02240Help
Entry
NGR_c02240        CDS       T00888                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGR_c02240 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    NGR_c02240 (hisD)
Enzymes [BR:rhi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     NGR_c02240 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
255437..256819
Genome map
AA seq 460 aa AA seqDB search
MGNRVQAASSRRRLSRAPATTKRIIALAIRLNFLDSGFERDFAAFLTTKREVSEDVNAVV
RAIIDDVRARGDAALADYSARFDGVDFSVTPMAVSAAEIDAAIDAVEPEVLGALKVAATR
IEAHHRRQLPKDDLYEDKMGVGLGSRWTAIDAVGLYVPGGTASYPSSVLMNALPAKVAGV
PRIVMVVPTRGGAINPAVLAAARLAGVEEIYRIGGAQAVASLAYGTETIAPVAKIMGPGN
AYVAAAKRQVFGTVGIDMIAGPSEVLVIADRDNDPDWIAADLLAQAEHDAGAQAILITDD
AAFGASVEQAVERQLKTLPRSETATASWRDFGAVILVPDLDKAVPLANRIAAEHLELAMA
DPDSMVPKIRNAGAIFIGRHTPEVIGDYVGGSNHVLPTARSARFSSGLGVLDYMKRTSIL
RLGPEQLRILGPAAIALAKSEGLEAHARSVAIRLNFGEEG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaccgcgttcaggccgcgtcatcccgaaggcgactgagcagagcgcccgccacc
accaagaggatcatcgcattggcaatccggttgaactttctcgacagcggcttcgaacgt
gacttcgccgcgttcctgaccaccaagcgggaggtttccgaagacgtcaacgccgtggtg
cgcgccatcatcgacgacgtgcgggcccgcggcgacgcggcgctcgccgactattccgcc
cgcttcgacggcgtcgatttcagcgtcacgccgatggcggtcagcgcggccgagatcgac
gcggcgatcgacgcggtcgagccggaggtgctcggcgcgctcaaggttgcggcgacccgc
atcgaggcgcatcaccgccggcaactgccgaaggacgatctctacgaagataagatgggc
gtcggcctcggctcgcgctggacggcgatcgatgcggtcgggctttacgtcccgggcggc
acggcgagctatccgagctcggtgctgatgaatgcgctgccggccaaggtcgccggcgtg
ccgcgcatcgtcatggtcgtgccgacgagggggggcgcgatcaatccggccgtgctggcg
gcagcaaggcttgccggcgtcgaggaaatctatcgcatcggcggcgcccaggccgtcgcc
tcacttgcctacggcacggagacgatcgcgccggtggcgaagatcatgggtcccggcaat
gcctatgtcgcggccgccaagcggcaagtcttcggcaccgtcggcatcgacatgatcgcc
ggcccctcggaggtgctggtgatcgccgaccgcgacaacgacccggactggatcgccgcg
gacctcctggcgcaggccgaacacgatgccggtgcccaggcgatcctgatcaccgatgac
gccgccttcggcgcgtcggtcgaacaggcggtcgagcggcagctgaagacgctgccgcgc
agcgagacggcgacggcaagctggcgcgacttcggcgcagtgatcctggtgcccgatctc
gacaaggcggtgccgctcgccaaccgaatcgccgcggagcacctcgagctggcgatggcc
gacccggattcgatggtgccgaagatccgcaatgccggcgccattttcattggccgccac
acgccggaggtgatcggcgactatgtcggcggctccaaccacgtgctgccgacggcgcgc
tcggcgcgcttctcctccggcctcggcgtgctcgactatatgaagcggacctccattcta
cggctcgggcccgaacaactgcgcatcctcggcccggcggcgattgcgctggccaagtcg
gaaggacttgaggcgcatgcccgctccgttgccatccgcctcaatttcggggaagaggga
tga

DBGET integrated database retrieval system