KEGG   Sinorhizobium fredii NGR234: NGR_c04560Help
Entry
NGR_c04560        CDS       T00888                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:rhi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(507667..508635)
Genome map
AA seq 322 aa AA seqDB search
MPRRRCRRSPPRRTRNPDSMPADGIAGFALTLAAPAKINLALHVVGQRADGHHLLESLVT
FAECGDRIAFAPADADHFTVSGPFSRDLPVSADGKSGNLVLRARDLLRRELIGRGAPTTS
VHLHLEKNLPIASGIGGGSADAAATLRGLLSLWKAEIAPERLASLALELGADVPMCLDGR
PLLARGIGEEIAPLADLPSFAIVLVNPLVAVSTPVIFRMLAEKRNPPLALPHGAHTAAAW
LAALADMRNDLERPARALEPAVETVSDALQAVRADLVRMSGSGATCFGLFDSDEKAGAAA
QRISADQPGWYVLATRTAGKRG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggagacgctgccgaagaagcccgccgcgccggacaagaaatcctgatagcatg
ccggccgacggcatcgccggcttcgcgctgacccttgcggcgccggccaagatcaacctg
gcactgcatgtcgtcggtcagcgcgccgacggacatcatcttctggaaagcctcgtcacc
ttcgcagagtgcggcgaccggatcgcattcgcgccagcggatgccgaccacttcaccgta
tccggcccgttttcgcgcgatctgccggtctcggcggacggcaagagcggcaatctggta
ttgcgggctcgcgatcttttgcggcgggagctgatcggacggggcgctccgaccacctct
gtgcatctgcatctggagaagaacctgccgatcgcctccgggatcggcgggggctcggcc
gacgcggccgccacgcttcgcggcctgctttcgctctggaaagccgagatcgcgccggaa
aggctcgccagcctcgccctggaacttggcgccgatgtgccgatgtgtctcgacggcagg
ccgctgcttgccagggggatcggcgaagagatcgccccgcttgccgatctgccgtccttt
gcgatcgttctcgtcaatccgctcgtcgccgtctcgacgcccgtcatctttcggatgctc
gccgagaagcgcaatcctcccctcgccctgccgcacggcgcccataccgccgcggcctgg
ctggcagccctcgccgacatgcgcaacgatctggagcggccggcgagagcgctggaaccg
gcggtcgagacggtatcggacgcgttgcaagcggtgcgtgccgatctcgtacggatgtcc
ggctcgggcgccacgtgtttcggtctgttcgacagcgacgaaaaggcgggcgcggccgcg
cagcgcatttccgccgatcagccgggatggtacgttctagccacccgaaccgcggggaag
cgaggataa

DBGET integrated database retrieval system