KEGG   Sinorhizobium fredii NGR234: NGR_c05430Help
Entry
NGR_c05430        CDS       T00888                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGR_c05430 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGR_c05430 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NGR_c05430 (thrC)
Enzymes [BR:rhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NGR_c05430 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(598467..599864)
Genome map
AA seq 465 aa AA seqDB search
MKYISTRGEAAPLGFCDALLAGLARDGGLYLPKEWPTFSKKEIRALRGKSYQEIAFTVLQ
PFTNGEIPAAKFREMIDGAYATFRHPAIAPLVQTGPNAFVMELFHGSTLAFKDVAMQLLA
RLMDHVLAERGERATIVGATSGDTGGAAIDAFAGRDRTDIFILFPHGKVSPVQQRQMTTA
NASNVHAIAVNGNFDDCQNLVKAMFNDTAFRDRVKLSGVNSINWARIMAQIVYYFTTAIA
LGGPDRKISFTVPTGNFGDIFAGYVAKRMGLPIDKLIIATNENDILARTLKTGRYEMREV
KATTSPSMDIQISSNFERLLFEAFGREASEVRAAMASLKQSGSFAIEEGALKKIRKEFRA
GRASEKQVAATIRDTFKKSGYLLDPHTAIGVSVAAKHEKPSAPMVVLGTAHPAKFPDAVK
SASGIDPTLPTWLADLMTRAERFDILDAELKNVETFIGERTRVQK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtatatctcgacgcgcggggaagcagcgcccctcggtttctgcgacgctcttctg
gcagggcttgcccgggatggcggcctctacctgccaaaggaatggccgaccttctcgaag
aaggaaatccgggcgctgcgcggcaaatcctaccaggaaatcgccttcacggttctccag
cccttcacaaacggcgaaatcccggcggcgaagttccgcgagatgatcgacggggcctac
gccaccttccgccatccggccattgcgccgctcgtccagaccggccccaacgcattcgtc
atggaactcttccacggttcgacgctggccttcaaggacgtcgccatgcaattgctggcg
cgcctcatggaccatgtgcttgccgagcgcggcgaacgggcgacgatcgtcggggcgacc
tccggcgatacgggaggtgcagcgatcgacgcctttgccggtcgggatcggaccgacatc
ttcatcctcttcccgcatggaaaggtctcgccggtccagcagaggcagatgacgaccgcc
aatgcatcgaacgtgcatgcgatcgccgtcaacggcaatttcgacgattgccagaacctg
gtcaaagccatgttcaacgacacggcctttcgcgatcgggtcaagctgtcgggcgtcaac
tcgatcaactgggcgcgcatcatggcgcagatcgtctactatttcacgacggcaatcgcg
cttggcggcccggaccggaagatctccttcaccgtgccgaccggcaattttggcgatatc
ttcgccggctatgtagccaagcgcatgggcctgccgatcgacaagctcatcatcgccacc
aacgagaacgacattctggcgcgcacgctgaagaccggccgctacgagatgcgcgaggtg
aaggcgacgacgtcgccgtcgatggacatccagatctcgtccaacttcgagcggctgctg
ttcgaagcctttgggcgcgaggcttccgaggtgcgcgccgccatggcaagcctcaagcaa
tccggttcctttgcgatcgaagagggcgccctgaaaaaaattcgcaaggaatttcgcgca
gggcgcgcctcggagaagcaggtggccgcaaccatccgcgacactttcaagaaatcgggc
tatctccttgatccgcatacggcaatcggcgtctcagtcgccgccaagcacgagaagcca
tcggcaccgatggtggttctcggcaccgcccaccccgcgaaatttcccgacgcggtaaaa
tcggcaagtggtattgaccccacgcttccgacgtggcttgctgatctgatgactagggcg
gagcgtttcgatatcctggatgctgagctgaaaaacgtcgaaaccttcatcggcgagcgt
acccgcgttcaaaaatag

DBGET integrated database retrieval system