KEGG   Sinorhizobium fredii NGR234: NGR_c05430Help
Entry
NGR_c05430        CDS       T00888                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00260  Glycine, serine and threonine metabolism
rhi00750  Vitamin B6 metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01230  Biosynthesis of amino acids
Module
rhi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGR_c05430 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NGR_c05430 (thrC)
Enzymes [BR:rhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NGR_c05430 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 7791769
NCBI-ProteinID: YP_002825092
RhizoBase: NGR_c05430
UniProt: C3MHL1
Position
complement(598467..599864)
Genome map
AA seq 465 aa AA seqDB search
MKYISTRGEAAPLGFCDALLAGLARDGGLYLPKEWPTFSKKEIRALRGKSYQEIAFTVLQ
PFTNGEIPAAKFREMIDGAYATFRHPAIAPLVQTGPNAFVMELFHGSTLAFKDVAMQLLA
RLMDHVLAERGERATIVGATSGDTGGAAIDAFAGRDRTDIFILFPHGKVSPVQQRQMTTA
NASNVHAIAVNGNFDDCQNLVKAMFNDTAFRDRVKLSGVNSINWARIMAQIVYYFTTAIA
LGGPDRKISFTVPTGNFGDIFAGYVAKRMGLPIDKLIIATNENDILARTLKTGRYEMREV
KATTSPSMDIQISSNFERLLFEAFGREASEVRAAMASLKQSGSFAIEEGALKKIRKEFRA
GRASEKQVAATIRDTFKKSGYLLDPHTAIGVSVAAKHEKPSAPMVVLGTAHPAKFPDAVK
SASGIDPTLPTWLADLMTRAERFDILDAELKNVETFIGERTRVQK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtatatctcgacgcgcggggaagcagcgcccctcggtttctgcgacgctcttctg
gcagggcttgcccgggatggcggcctctacctgccaaaggaatggccgaccttctcgaag
aaggaaatccgggcgctgcgcggcaaatcctaccaggaaatcgccttcacggttctccag
cccttcacaaacggcgaaatcccggcggcgaagttccgcgagatgatcgacggggcctac
gccaccttccgccatccggccattgcgccgctcgtccagaccggccccaacgcattcgtc
atggaactcttccacggttcgacgctggccttcaaggacgtcgccatgcaattgctggcg
cgcctcatggaccatgtgcttgccgagcgcggcgaacgggcgacgatcgtcggggcgacc
tccggcgatacgggaggtgcagcgatcgacgcctttgccggtcgggatcggaccgacatc
ttcatcctcttcccgcatggaaaggtctcgccggtccagcagaggcagatgacgaccgcc
aatgcatcgaacgtgcatgcgatcgccgtcaacggcaatttcgacgattgccagaacctg
gtcaaagccatgttcaacgacacggcctttcgcgatcgggtcaagctgtcgggcgtcaac
tcgatcaactgggcgcgcatcatggcgcagatcgtctactatttcacgacggcaatcgcg
cttggcggcccggaccggaagatctccttcaccgtgccgaccggcaattttggcgatatc
ttcgccggctatgtagccaagcgcatgggcctgccgatcgacaagctcatcatcgccacc
aacgagaacgacattctggcgcgcacgctgaagaccggccgctacgagatgcgcgaggtg
aaggcgacgacgtcgccgtcgatggacatccagatctcgtccaacttcgagcggctgctg
ttcgaagcctttgggcgcgaggcttccgaggtgcgcgccgccatggcaagcctcaagcaa
tccggttcctttgcgatcgaagagggcgccctgaaaaaaattcgcaaggaatttcgcgca
gggcgcgcctcggagaagcaggtggccgcaaccatccgcgacactttcaagaaatcgggc
tatctccttgatccgcatacggcaatcggcgtctcagtcgccgccaagcacgagaagcca
tcggcaccgatggtggttctcggcaccgcccaccccgcgaaatttcccgacgcggtaaaa
tcggcaagtggtattgaccccacgcttccgacgtggcttgctgatctgatgactagggcg
gagcgtttcgatatcctggatgctgagctgaaaaacgtcgaaaccttcatcggcgagcgt
acccgcgttcaaaaatag

DBGET integrated database retrieval system