KEGG   Sinorhizobium fredii NGR234: NGR_c06610Help
Entry
NGR_c06610        CDS       T00888                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NGR_c06610 (tpiA)
   01230 Biosynthesis of amino acids
    NGR_c06610 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_c06610 (tpiA)
   00051 Fructose and mannose metabolism
    NGR_c06610 (tpiA)
   00562 Inositol phosphate metabolism
    NGR_c06610 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NGR_c06610 (tpiA)
Enzymes [BR:rhi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NGR_c06610 (tpiA)
Exosome [BR:rhi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NGR_c06610 (tpiA)
  Exosomal proteins of bladder cancer cells
   NGR_c06610 (tpiA)
  Exosomal proteins of melanoma cells
   NGR_c06610 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
717971..718756
Genome map
AA seq 261 aa AA seqDB search
MTGKSRFWIGTSWKMNKTLAEAEHFVRGLKAADATHDPRIQRFVIPAFTVLREVRAMLAQ
TSVKVGAQNMHWADQGAWTGEVSPLMLKDCNLDLVELGHSERREHFGETDETVGLKTEAA
VRHGLIPLICVGETLRDRDSGNAPEVLAAQVRGALSKLTASQKTAEVLLAYEPVWAIGEK
GIPATAEYAGARQAEIIAVAEEVVGRKVPCLYGGSVNPQNCEELISSPHIDGLFIGRSAW
NVEGYLDILAKCAAKLRGERE
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaatcgcgcttctggattggcaccagctggaagatgaacaagacgcttgcg
gaggccgagcactttgtgcgcggcctcaaggccgcagatgcgacgcatgatccgcgcatc
cagcgtttcgtcattccggctttcaccgtccttcgcgaggtcagggcaatgctcgcccaa
acctccgtgaaggtcggcgcgcagaacatgcactgggccgaccagggcgcttggacgggc
gaagtctcgccgctgatgctgaaggactgcaatctcgatctggtcgaactcggccactct
gagcggcgtgaacacttcggggagaccgacgaaacggtgggcttaaagaccgaagccgcc
gtccggcacggtcttattccgctgatctgcgtaggtgagacgctgagggaccgcgacagc
ggtaacgcaccggaagtcctggccgcccaggtacgcggcgcgctttcgaaattgaccgct
tcgcagaaaacggccgaggtcctccttgcctacgagcccgtctgggccatcggcgagaag
ggcatcccggcaaccgccgagtacgcaggtgcgcgtcaggccgaaattatagctgtcgcc
gaagaggtggtcggccgaaaggtcccctgcctctatggcgggtcggtcaatccgcagaac
tgcgaagaactgatttcgagcccgcacatcgacgggctgttcatcggccgttcggcatgg
aacgtcgaggggtacctcgacatccttgcgaaatgcgccgccaaactccgaggagagaga
gaatga

DBGET integrated database retrieval system