KEGG   Sinorhizobium fredii NGR234: NGR_c06610Help
Entry
NGR_c06610        CDS       T00888                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
rhi  Sinorhizobium fredii NGR234
Brite
Enzymes [BR:rhi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     NGR_c06610 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
717971..718756
Genome map
AA seq 261 aa AA seqDB search
MTGKSRFWIGTSWKMNKTLAEAEHFVRGLKAADATHDPRIQRFVIPAFTVLREVRAMLAQ
TSVKVGAQNMHWADQGAWTGEVSPLMLKDCNLDLVELGHSERREHFGETDETVGLKTEAA
VRHGLIPLICVGETLRDRDSGNAPEVLAAQVRGALSKLTASQKTAEVLLAYEPVWAIGEK
GIPATAEYAGARQAEIIAVAEEVVGRKVPCLYGGSVNPQNCEELISSPHIDGLFIGRSAW
NVEGYLDILAKCAAKLRGERE
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaatcgcgcttctggattggcaccagctggaagatgaacaagacgcttgcg
gaggccgagcactttgtgcgcggcctcaaggccgcagatgcgacgcatgatccgcgcatc
cagcgtttcgtcattccggctttcaccgtccttcgcgaggtcagggcaatgctcgcccaa
acctccgtgaaggtcggcgcgcagaacatgcactgggccgaccagggcgcttggacgggc
gaagtctcgccgctgatgctgaaggactgcaatctcgatctggtcgaactcggccactct
gagcggcgtgaacacttcggggagaccgacgaaacggtgggcttaaagaccgaagccgcc
gtccggcacggtcttattccgctgatctgcgtaggtgagacgctgagggaccgcgacagc
ggtaacgcaccggaagtcctggccgcccaggtacgcggcgcgctttcgaaattgaccgct
tcgcagaaaacggccgaggtcctccttgcctacgagcccgtctgggccatcggcgagaag
ggcatcccggcaaccgccgagtacgcaggtgcgcgtcaggccgaaattatagctgtcgcc
gaagaggtggtcggccgaaaggtcccctgcctctatggcgggtcggtcaatccgcagaac
tgcgaagaactgatttcgagcccgcacatcgacgggctgttcatcggccgttcggcatgg
aacgtcgaggggtacctcgacatccttgcgaaatgcgccgccaaactccgaggagagaga
gaatga

DBGET integrated database retrieval system