KEGG   Sinorhizobium fredii NGR234: NGR_c08980Help
Entry
NGR_c08980        CDS       T00888                                 

Gene name
ksgA
Definition
(RefSeq) dimethyladenosine transferase (EC:2.1.1.-)
  KO
K02528  
16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC:2.1.1.182]
Organism
rhi  Sinorhizobium fredii NGR234
Brite
Enzymes [BR:rhi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.182  16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase
     NGR_c08980 (ksgA)
Ribosome biogenesis [BR:rhi03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    NGR_c08980 (ksgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(954309..955199)
Genome map
AA seq 296 aa AA seqDB search
MAALDGLPPLRDVIQRHGLDAKKALGQNFLLDLNLTQKIARTAGPLEDVTVIEVGPGPGG
LTRAILALGARKVVAIERDPRCLPALAEISAHYPGRLDVVEGDALKVDFERLAEGPVRII
ANLPYNVGTQLLVNWLLPERWPPFWQSMTLMIQREVGLRIVAGADDDHYGRLGVLCGWRT
KARLAFDVPPQAFTPPPKVTSTVVHLEPIDNPIPCAVSALEKVTQAAFGQRRKMLRQSLK
SIGGEALLGKAGIDPQRRAETLTVEEFCRLANCLLGEKVPRSGAAPLRTGFPSEDR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcagcactcgacggtctgccgccgcttcgcgacgtcatccagcgccacgggctcgat
gcgaagaaagcgctcgggcagaatttcctgctcgacctcaatctcacccagaagatcgcc
cgcacggccggccccctcgaagacgtcaccgtcatcgaagtcggcccaggccccgggggg
ctgacgcgcgccatcctggcgctcggcgccaggaaggtcgtggcaatcgaacgcgacccg
cgctgcctgccggcacttgccgaaatcagcgcccactatcccggccggctcgacgtcgtc
gaaggcgacgccttgaaggtggatttcgagcgcctcgccgagggaccggtgcgtatcatc
gccaacctgccctacaatgtcggcacgcagcttctcgtcaattggctgctgcccgagcgc
tggccgcccttctggcagtcgatgacgctgatgatccagcgggaagttggcttgcggatc
gtcgccggcgccgacgacgatcactatggccgcctcggcgtcctctgtggctggcgcacc
aaggcgcgcctggccttcgacgtgccgccgcaggccttcaccccgcctccgaaggtgacc
tccacggtcgtgcatctcgagccgatcgacaatccgattccatgcgcggtctcggcgctc
gagaaggtcacgcaggcggccttcggccagcgccgcaagatgctgcgccagagcctcaag
tcgatcggcggcgaagcgctgctcggcaaggcaggcatcgacccgcaacggcgggccgag
acgctgacggtcgaagagttctgccggctggcgaattgcctgttgggggaaaaggtaccg
cgatccggggccgcgcccctcagaacgggttttccgtcagaagaccgttga

DBGET integrated database retrieval system