KEGG   Sinorhizobium fredii NGR234: NGR_c09530Help
Entry
NGR_c09530        CDS       T00888                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rhi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1019277..1020290)
Genome map
AA seq 337 aa AA seqDB search
MNDRTNLVDRITGHRRMRRNRKADWTRRLVQENRLTVDDLIWPIFIVPGSGIVQPIEAMP
GVSRMSIDKAVEAVREAADLGIPAVATFPNIEMALRDETGSNSLAADNLINEATRAIRKA
VPNIGVITDVALDPFTSHGHDGILRAGEIVNDETVEAVARAAVIQADAGSDIIAPSEMMD
GRIGAIRQALDAAGHQNVGIMSYATKFASAFYGPYREAIGTGGLLKGDKKSYYIDPANGT
EAIRDAALDVEEGADMLMVKPGLPYLDICWRMKEAFGLPVFAYQVSGEYTQIKAAAANGW
IDGERVMLETLLAFKRAGCDGILSYFAVEVARILAKR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaggacaaatcttgtggacaggatcaccggacaccgtcggatgcgccgcaac
cgcaaggcggactggacgcgccgcctggtgcaggagaaccggctgaccgtcgacgacctg
atctggccgatcttcatcgtgccgggaagcggcatcgttcagccgatcgaagcgatgccc
ggcgtcagccgcatgagcatcgacaaggccgtcgaggcggtcagggaggcggccgacctc
ggcattcccgccgtcgccaccttcccgaacatcgagatggcgctccgcgacgaaaccggc
tcgaacagccttgccgccgacaacctcatcaacgaggcgacgcgggcgatcaggaaggcc
gtgccgaatattggcgtcattaccgacgtcgcgctcgatccgttcaccagccacggccat
gacggcatcctgcgcgccggcgagatcgtcaacgacgagacggtggaggcggtcgcccgc
gccgccgtcatccaggcggatgccggctccgacatcatcgcaccttccgaaatgatggac
gggcggatcggcgccatccgccaggcgctcgatgcggccggccaccagaatgtcggcatc
atgtcctatgcgacgaagttcgcctcggccttctacggcccctatcgcgaggcgatcggc
accggcggcctgctgaagggcgacaagaagtcctactacatcgatccggccaacggcacc
gaggcgatccgcgacgccgcgctcgacgtcgaggaaggcgccgacatgttgatggtgaaa
ccgggcctgccctatctcgacatctgctggcggatgaaggaagccttcggcctgccggtc
ttcgcctatcaggtctcgggcgaatacacgcagatcaaggcggcagccgccaacggctgg
atcgacggcgagcgcgtcatgctcgagacgctactcgccttcaagcgcgccggctgcgac
ggcatcctcagctatttcgccgtcgaagtggcgaggatcctggcaaaacgctga

DBGET integrated database retrieval system