KEGG   Sinorhizobium fredii NGR234: NGR_c10900Help
Entry
NGR_c10900        CDS       T00888                                 

Gene name
pyrB
Definition
(RefSeq) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00240  Pyrimidine metabolism
rhi00250  Alanine, aspartate and glutamate metabolism
rhi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NGR_c10900 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NGR_c10900 (pyrB)
Enzymes [BR:rhi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     NGR_c10900 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-GeneID: 7792963
NCBI-ProteinID: YP_002825629
RhizoBase: NGR_c10900
UniProt: C3MA97
Position
complement(1156818..1157759)
Genome map
AA seq 313 aa AA seqDB search
MITFPHRHLLGIKGLTEQDITLLLDRADEAVKISRQREKKTSSLRGLTQINLFFEASTRT
QSSFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTLNAMHPDVLVVRHSSAGAAALLA
QKVSCSVVNAGDGQHEHPTQALLDALTIRRAKGKLSRIIVAICGDVLHSRVARSNILLLN
QMGARVRVVAPATLLPAGIEQMGAEVYRSMAEGLKDADVVMMLRLQRERMAGSFVPSVRE
YFHYYGLDAETLKAAKDDALVMHPGPMNRGVEIASEVADGPQSVIEQQVEMGVAVRMAVM
ETLLLSQDQGPRP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatcactttcccgcatcgccacctgctcggcatcaaggggctgacggagcaggacatc
acgctcctgctcgatcgcgccgacgaagcggtcaaaatctcccggcagagggagaagaag
acctcttcactgcgcgggctgacgcagatcaacctcttcttcgaagcctcgacccgcacg
caatcgtccttcgaactggccggcaagcggcttggcgccgacgtcatgaacatgtcggtc
ggcaactcctcggtgaagaagggcgagacgctgatcgacacggcgatgacgctgaatgcg
atgcatccggacgtgctcgtcgtgcgccactcctcggccggcgccgcagcactgctcgcg
cagaaggtctcctgctcggtcgtcaacgccggcgacggccagcacgagcatccgacgcag
gcgcttctcgacgcgctgacgatccgccgcgccaagggcaagctgtcgcggatcatcgtg
gcgatctgcggcgacgtcctgcattcccgcgtcgcccgctccaacatcctgctgctcaac
cagatgggcgcccgtgtccgcgtcgtcgcaccggcgaccttgcttcccgccggcatagaa
cagatgggcgcagaggtctatcgatccatggcggagggcctgaaggatgcggacgtggtg
atgatgctgcggctccagcgcgagcgcatggccggctccttcgtgccgtcggtgcgcgaa
tacttccactattacgggctcgacgcggaaacgctgaaggcggccaaggacgatgcgctc
gtcatgcatccgggccccatgaaccgcggcgtcgagatcgcgtccgaggtcgccgacgga
ccgcaaagcgtcatcgaacagcaggtcgagatgggtgtcgcggtgcgcatggccgtcatg
gaaacacttcttctctcgcaggaccaggggccgcgcccatga

DBGET integrated database retrieval system