KEGG   Sinorhizobium fredii NGR234: NGR_c12760Help
Entry
NGR_c12760        CDS       T00888                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rhi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rhi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rhi00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rhi00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:rhi00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:rhi00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1315349..1316119
Genome map
AA seq 256 aa AA seqDB search
MTPDIRPLVAGNWKMNGTRASLDQIKAMAEGVKGALSAKVETLICPPATLLYVATALCDD
SPLMIGAQDCHQKQSGAHTGEISAEMIADCFGTHVIVGHSERRTDHAETDALVRAKTEAA
HAAALVAIVCIGETEEERKSGKTLDVLKRQLAESLPDAATAENTVIAYEPVWAIGTGLTP
TVGDVEEAHAFMRRELVSRFGSEGGKMRILYGGSVKPSNATELMGVANVDGALIGGASLK
AEDFLAIYGAYEELTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatatccgcccgctggttgccggcaactggaagatgaatggcacgcgtgca
tcgctggaccagatcaaggcgatggccgaaggcgtcaagggcgcactttccgcaaaggtg
gagacgctgatctgcccgccggcgacgctgctctatgttgcgaccgcgctttgcgacgac
agtccgctgatgatcggcgcccaggactgccaccagaaacagtcgggtgcccataccggc
gagatttccgccgagatgatcgccgattgcttcggcacgcacgtcatcgtcggccactcg
gaacgccgcaccgatcatgccgagaccgatgcgctggtcagggcgaagacggaagccgcg
cacgccgcggcgctcgtcgccatcgtctgcatcggcgagaccgaagaagagcgcaagagc
ggcaagacgctcgacgtgctgaagcgccagctcgccgaaagcctgccagatgccgcgacg
gctgagaacaccgtgatcgcctatgagccggtctgggcgatcggtacgggcctgacgccg
accgtcggagatgtcgaggaggcgcatgccttcatgcggcgtgaactcgtctcccgcttt
ggttcggaaggcggcaagatgcggatcctttacggcggctccgtcaagccctccaatgcc
acggaattgatgggcgtcgccaatgtggacggcgccctgatcggcggcgccagcttgaaa
gcggaagacttcctcgccatctacggggcctatgaagaattgactgcgtga

DBGET integrated database retrieval system