KEGG   Sinorhizobium fredii NGR234: NGR_c12760Help
Entry
NGR_c12760        CDS       T00888                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00010  Glycolysis / Gluconeogenesis
rhi00051  Fructose and mannose metabolism
rhi00562  Inositol phosphate metabolism
rhi00710  Carbon fixation in photosynthetic organisms
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01200  Carbon metabolism
rhi01230  Biosynthesis of amino acids
Module
rhi_M00002  Glycolysis, core module involving three-carbon compounds
rhi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_c12760 (tpiA)
   00051 Fructose and mannose metabolism
    NGR_c12760 (tpiA)
   00562 Inositol phosphate metabolism
    NGR_c12760 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NGR_c12760 (tpiA)
Enzymes [BR:rhi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NGR_c12760 (tpiA)
Exosome [BR:rhi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NGR_c12760 (tpiA)
  Exosomal proteins of bladder cancer cells
   NGR_c12760 (tpiA)
  Exosomal proteins of melanoma cells
   NGR_c12760 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 7793149
NCBI-ProteinID: YP_002825810
RhizoBase: NGR_c12760
UniProt: C3MBJ5
Position
1315349..1316119
Genome map
AA seq 256 aa AA seqDB search
MTPDIRPLVAGNWKMNGTRASLDQIKAMAEGVKGALSAKVETLICPPATLLYVATALCDD
SPLMIGAQDCHQKQSGAHTGEISAEMIADCFGTHVIVGHSERRTDHAETDALVRAKTEAA
HAAALVAIVCIGETEEERKSGKTLDVLKRQLAESLPDAATAENTVIAYEPVWAIGTGLTP
TVGDVEEAHAFMRRELVSRFGSEGGKMRILYGGSVKPSNATELMGVANVDGALIGGASLK
AEDFLAIYGAYEELTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatatccgcccgctggttgccggcaactggaagatgaatggcacgcgtgca
tcgctggaccagatcaaggcgatggccgaaggcgtcaagggcgcactttccgcaaaggtg
gagacgctgatctgcccgccggcgacgctgctctatgttgcgaccgcgctttgcgacgac
agtccgctgatgatcggcgcccaggactgccaccagaaacagtcgggtgcccataccggc
gagatttccgccgagatgatcgccgattgcttcggcacgcacgtcatcgtcggccactcg
gaacgccgcaccgatcatgccgagaccgatgcgctggtcagggcgaagacggaagccgcg
cacgccgcggcgctcgtcgccatcgtctgcatcggcgagaccgaagaagagcgcaagagc
ggcaagacgctcgacgtgctgaagcgccagctcgccgaaagcctgccagatgccgcgacg
gctgagaacaccgtgatcgcctatgagccggtctgggcgatcggtacgggcctgacgccg
accgtcggagatgtcgaggaggcgcatgccttcatgcggcgtgaactcgtctcccgcttt
ggttcggaaggcggcaagatgcggatcctttacggcggctccgtcaagccctccaatgcc
acggaattgatgggcgtcgccaatgtggacggcgccctgatcggcggcgccagcttgaaa
gcggaagacttcctcgccatctacggggcctatgaagaattgactgcgtga

DBGET integrated database retrieval system