KEGG   Sinorhizobium fredii NGR234: NGR_c12850Help
Entry
NGR_c12850        CDS       T00888                                 

Definition
(RefSeq) pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00010  Glycolysis / Gluconeogenesis
rhi00020  Citrate cycle (TCA cycle)
rhi00620  Pyruvate metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01200  Carbon metabolism
Module
rhi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_c12850
   00020 Citrate cycle (TCA cycle)
    NGR_c12850
   00620 Pyruvate metabolism
    NGR_c12850
Enzymes [BR:rhi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NGR_c12850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 DUF2118 QRPTase_N GCV_H ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-GeneID: 7793158
NCBI-ProteinID: YP_002825819
RhizoBase: NGR_c12850
UniProt: C3MBK4
Position
1325548..1326891
Genome map
AA seq 447 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAADGEDVATAAKGNGAAAPASAAKAEAPAPAAPAAAPAPAAAP
TAPAAASAPAAAGGDGKRVFSSPLARRLAKEAGIDLSAVAGTGPYGRVVKKDVESAVSGG
AAKPAAAPAAAQAPAAAPLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLQESKQTI
PHFYVSLDCQLDALLALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSW
TDTNMVKHKHADVGVAVSIPGGLITPIIRQAELKSLSAISNEMKDYGKRAKERKLKPEEY
QGGTTAVSNMGMMGVKNFAAVVNPPHATILAVGAGEERVIVKNKEMVVANMMTVTLSTDH
RCVDGALGAELLGAFKRYIENPMGMLV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacatcacaatgcctgccctctctccgaccatggaagaaggcaatctcgcc
aagtggctggtcaaggaaggcgacaaggtcaagtccggcgacgtcatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgatgagggcaccgtcgccaagatcgtc
gtcccggccggtaccgaaggcgttaaggtcaatgccttgatcgcggttctggccgccgat
ggcgaggacgtcgcaacggcggcgaagggcaatggcgccgccgcgccggcgtccgccgcc
aaggcagaggcacctgctccggcagcgcctgccgcagcacctgcgccggccgcggccccg
accgctccggccgcagcttcagcgccggccgccgccgggggcgacggaaagcgcgtcttc
tcctcgccgctcgcccgtcgccttgccaaggaagcgggcatcgacctctccgcagttgcc
ggtaccggcccctacggccgcgtcgtcaagaaggatgtggaatccgcggtctccggtggc
gccgccaagccggccgcagcaccggctgccgctcaggcaccggccgcggcaccgctcgcc
aagggcatgtcggaagacgccgtcctcaagctcttcgagccgggctcgtacgagctcgtc
ccgcatgacggcatgcgcaagacgattgccaagcgcctgcaggaatcgaagcagacgatc
ccgcacttctacgtctccctcgattgccagctcgatgcgctgctggcgctgcgcgcccag
ctcaacgccgctgcacccgagaaggacggcaagccggtctacaagctctcggtcaacgac
atggtgatcaaggcgctggcgctggcgttgcgcgacgttccggatgcgaatgtgtcctgg
accgacacgaacatggtcaagcacaagcatgccgatgtcggcgttgccgtgtcgatcccg
ggcgggctgatcacgccgatcatccgccaggcggagctgaagagcttgtccgccatctcc
aacgagatgaaggactacggcaagcgcgccaaggagcgcaagctgaagcccgaggaatac
cagggtggcaccaccgcggtttccaacatgggcatgatgggcgtcaagaacttcgcagcc
gtcgtcaacccgccgcatgcgacgatcctcgcggtcggcgccggcgaggagcgcgtcatc
gtcaagaacaaggagatggtcgtcgccaacatgatgaccgtcacgctctcgaccgaccat
cgctgcgtcgatggcgcgctcggcgccgaactgctcggtgccttcaagcgctacatcgaa
aacccgatgggcatgctcgtctga

DBGET integrated database retrieval system