KEGG   Sinorhizobium fredii NGR234: NGR_c13510Help
Entry
NGR_c13510        CDS       T00888                                 

Definition
(RefSeq) protein-l-isoaspartate o-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rhi  Sinorhizobium fredii NGR234
Brite
Enzymes [BR:rhi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NGR_c13510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 RrnaAD Methyltransf_25 Methyltransf_12 Methyltransf_11 MTS GidB Methyltransf_23 Methyltransf_32 Methyltr_RsmB-F TehB Methyltransf_3
Motif
Other DBs
NCBI-GeneID: 7793224
NCBI-ProteinID: YP_002825884
RhizoBase: NGR_c13510
UniProt: C3MBR9
Position
1391749..1392408
Genome map
AA seq 219 aa AA seqDB search
MNFEAARIKMVDNQIRTTDVTSHSVLTAFLTVPREEFVPAKMKELAYIDTDIELVGGAAP
RHLMEPSPLAKLLQLARISKSDKVLEIGSGTGYASALLSLIAGSVVALESDESLIAAATE
TLARLGYGNAAVTSGDLTKGYAAEAPYDVIFINGAVEAIPAPLFEQLRDGGRLVAVEGFG
NASRAKLYTRESGRTSERSDFNTSVKPLPGFHRERSFIF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgaagcagcgcgcattaagatggtggacaaccagatccgaacgacggatgtg
acctcccattcggttctgactgccttcctcaccgtgccacgcgaggaattcgtgccggcg
aagatgaaggaactggcctatatcgacaccgatatcgagcttgtcggcggggccgcgccg
cgccacctcatggagccgtctccattggcgaaattgctgcaactcgcccgaatcagcaaa
tcggacaaggtcctcgagatcggttccgggacggggtacgcttccgccttgctgtcgctg
atcgccggctccgtggtggcgctggaaagcgatgagtcgctgattgccgcagcgactgaa
acgctggcgcgtctcggctatggcaacgctgcggtaacaagcggcgatctcaccaaggga
tatgcagccgaagccccctatgacgtgatctttatcaacggtgcggtcgaagctatccca
gccccgctcttcgagcagcttcgtgatggcggtcgcctcgtcgccgttgaagggtttggt
aacgcctcgcgtgcaaaactctacacgcgtgaatcgggcaggacttccgagcgatccgat
ttcaacacgtccgtgaagccgctgcctggcttccatcgcgagcggtcgtttattttctga

DBGET integrated database retrieval system