KEGG   Sinorhizobium fredii NGR234: NGR_c13670Help
Entry
NGR_c13670        CDS       T00888                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rhi00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:rhi00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1412003..1413019
Genome map
AA seq 338 aa AA seqDB search
MSESKAFISGCKGLSLTAEERSFFAGERPWGFILFGRNIGEKEQICDLVAALRDSVDNPK
APILIDQEGGRVQRIRPPLAQQYPSGAAIGEIYRRDVEMGLRAAWLLGRLHAFDLMRFGI
TVDCLPVLDVPVPGSHDVIGNRAYGHDPATVTAIGRAVGEGLKAGGMLPVMKHMPGHGRT
FVDSHHNLPVVDASLEELKRVDFQPFAAMKDEAMAMSAHMVFTAIDPDNPATTSARLVRE
IVRDYIGFDGLLMSDDVSMNALAGDMTTRARAIIGAGLDLVLHCHGIMEEMKAVADVVPV
LSRDRLRRAKAAEAAFRQPDGSDEDTMRAEFNAMFALA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatcaaaggcattcatctcgggctgcaaaggcctttccctgacggcggaggag
cgcagcttcttcgccggcgaacgcccctggggcttcattctcttcggccgcaacatcggt
gagaaagaacagatctgtgatctcgtcgcggccctgcgcgacagcgtcgataatccgaaa
gcgccgatcctgatcgatcaggagggcggccgcgtccagcgcattcgcccgccgctcgcg
caacaatatccgagcggtgcggcgatcggcgagatttaccgtcgcgacgttgagatgggg
ctgcgtgccgcatggctgcttgggcgcctccacgcgttcgatctcatgcgcttcggcatc
acggtggattgcctgccggtgctcgacgtgccggtccccggcagccatgacgtcatcggc
aaccgggcctatggacacgatccggcgaccgtgacggcgatcggccgtgcggtcggcgag
ggcctgaaagcgggcggcatgctgccggtgatgaagcacatgccgggtcacggccgcact
ttcgtcgattcgcatcacaacttgccggtggtcgacgcatcgctggaagagctgaagcgc
gtcgacttccagccttttgccgccatgaaggacgaggcgatggccatgtcggcccacatg
gtcttcacggcgatcgatccggacaatccggcgacgacatctgcaaggctcgtgcgggag
atcgtccgcgactatatcggctttgacggcttgctgatgtccgacgatgtttccatgaac
gcacttgcaggagatatgaccacccgcgcccgtgcgattatcggggcagggcttgatctc
gtcttgcattgtcacgggattatggaagaaatgaaggccgtcgccgatgtcgtgccggtt
ctttcgcgcgatcggttgcgcagggcgaaagcggccgaggcggccttccggcagccggat
ggttcggatgaagacacaatgcgagcggagttcaatgcgatgttcgcgctcgcctag

DBGET integrated database retrieval system