KEGG   Sinorhizobium fredii NGR234: NGR_c14310Help
Entry
NGR_c14310        CDS       T00888                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00630  Glyoxylate and dicarboxylate metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01200  Carbon metabolism
Module
rhi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NGR_c14310
Enzymes [BR:rhi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NGR_c14310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 7793303
NCBI-ProteinID: YP_002825957
RhizoBase: NGR_c14310
UniProt: C3MCC5
Position
complement(1469431..1471062)
Genome map
AA seq 543 aa AA seqDB search
MPSHTQHSFPEEIMSYEAYLDEASRLIKGNGNWSGITAESVARMRLQNRFRTGLDIARYT
ASIMRRDMAAYDKDPGKYTQSLGCWHGFIAQQKVISLKKHFGSTERRYLYLSGWMVAALR
SEFGPLPDQSMHEKTSVPALVEELYTFLRQADARELGTLFREIDKARSAGDRAREQQLTQ
AVNNHQTHVIPIIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDGKV
TVPHEEFVAKIRACRYAFLELGVDDGIIVARTDSLGAGLTKQIAFSASEGDIGDQYNSFL
DCEDVTDQKPSNGDVLITRGSRVLRPKRLRSNLYQFREGTGADRCVLDCINAIRNGADLL
WIETEKPHVEQIAGMMDRIRDVIPDAKLVYNNSPSFNWTLNFRQQIFDAWQKDGKDVSGF
DRARLMSEEYDGSELAREADERIRTFQRDASKRAGIFHHLITLPTYHTAALSTDNLAKEY
FGDQGMLGYVANVQRKEIRQGIACVKHQNMAGSDIGDDHKDYFAGEAALKAGGEHNTMNQ
FAA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcatacgcaacattcattcccggaggaaatcatgtcctatgaagcttatctc
gatgaagcatcccgcctgatcaagggcaacggcaactggagcggcataaccgctgaatcg
gttgcccgcatgcgtctgcagaaccgcttcaggaccggactggacatcgcgcgctacacg
gcttccatcatgcgccgggacatggccgcctacgataaggatccgggcaagtacacccag
tcgctcggttgctggcacggcttcatcgcacagcagaaggtcatctccctgaagaagcac
ttcggctcgacggaacggcggtacctttacctttccggttggatggttgcagcgcttcgc
tccgagttcggtccgcttccggaccagtccatgcatgagaagaccagcgttccggcgctg
gtcgaggagctttacaccttccttcgccaggccgatgcgcgcgagctcggcacattgttc
cgggagatcgacaaggcccgatcggccggtgacagggcgcgcgaacagcagcttacccag
gcggtcaacaaccaccagacgcacgtcatcccgatcatcgccgatatagatgccggcttc
ggcaatgccgaagcgacgtatttgctcgccaagaagatgatcgaagccggcgcctgcgcg
ctgcagatcgagaaccaggtttccgacgagaagcaatgcggccaccaggacggcaaggtg
accgttcctcacgaggagttcgtcgccaagatccgggcatgccgctacgcgtttctcgaa
ctcggcgtcgacgacggcatcatcgtcgcgcgaaccgactcgctcggtgcgggcctcacc
aagcagatcgccttcagcgccagcgaaggtgacatcggcgatcaatacaactcgttcctg
gattgcgaggacgtcacggatcaaaagccgtccaatggagacgtcctgatcaccagaggg
tcgagggtcctgcgtccgaagcggctgaggtcaaatctctaccagttccgcgaaggcacg
ggtgctgatcgctgtgtcctggattgcatcaacgcaatcaggaacggcgccgaccttctg
tggatcgagacggagaagccgcatgtcgagcagatcgccggaatgatggaccggatccgc
gacgtcatcccggatgcgaagctcgtctacaacaactctccctcgttcaactggacgctg
aatttccgccagcagatcttcgacgcctggcagaaggacggcaaggacgtctccggcttc
gacagggcgcggctgatgagcgaggagtacgacggcagcgaactggcgcgcgaagccgac
gagcgcatccgcaccttccagcgcgacgcctcgaaacgggccggcatcttccatcacctc
atcaccttgccgacctaccacaccgccgcgctttccaccgacaatcttgccaaggagtac
ttcggcgaccagggcatgctcggctacgtcgccaacgtgcagcgcaaggagatccgccag
ggcatcgcctgcgtgaagcaccagaacatggccggctccgacatcggcgacgaccacaag
gattatttcgccggcgaggccgccctcaaggcgggtggtgagcacaacaccatgaaccag
ttcgccgcctga

DBGET integrated database retrieval system