KEGG   Sinorhizobium fredii NGR234: NGR_c14310Help
Entry
NGR_c14310        CDS       T00888                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:rhi01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rhi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1469431..1471062)
Genome map
AA seq 543 aa AA seqDB search
MPSHTQHSFPEEIMSYEAYLDEASRLIKGNGNWSGITAESVARMRLQNRFRTGLDIARYT
ASIMRRDMAAYDKDPGKYTQSLGCWHGFIAQQKVISLKKHFGSTERRYLYLSGWMVAALR
SEFGPLPDQSMHEKTSVPALVEELYTFLRQADARELGTLFREIDKARSAGDRAREQQLTQ
AVNNHQTHVIPIIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDGKV
TVPHEEFVAKIRACRYAFLELGVDDGIIVARTDSLGAGLTKQIAFSASEGDIGDQYNSFL
DCEDVTDQKPSNGDVLITRGSRVLRPKRLRSNLYQFREGTGADRCVLDCINAIRNGADLL
WIETEKPHVEQIAGMMDRIRDVIPDAKLVYNNSPSFNWTLNFRQQIFDAWQKDGKDVSGF
DRARLMSEEYDGSELAREADERIRTFQRDASKRAGIFHHLITLPTYHTAALSTDNLAKEY
FGDQGMLGYVANVQRKEIRQGIACVKHQNMAGSDIGDDHKDYFAGEAALKAGGEHNTMNQ
FAA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcatacgcaacattcattcccggaggaaatcatgtcctatgaagcttatctc
gatgaagcatcccgcctgatcaagggcaacggcaactggagcggcataaccgctgaatcg
gttgcccgcatgcgtctgcagaaccgcttcaggaccggactggacatcgcgcgctacacg
gcttccatcatgcgccgggacatggccgcctacgataaggatccgggcaagtacacccag
tcgctcggttgctggcacggcttcatcgcacagcagaaggtcatctccctgaagaagcac
ttcggctcgacggaacggcggtacctttacctttccggttggatggttgcagcgcttcgc
tccgagttcggtccgcttccggaccagtccatgcatgagaagaccagcgttccggcgctg
gtcgaggagctttacaccttccttcgccaggccgatgcgcgcgagctcggcacattgttc
cgggagatcgacaaggcccgatcggccggtgacagggcgcgcgaacagcagcttacccag
gcggtcaacaaccaccagacgcacgtcatcccgatcatcgccgatatagatgccggcttc
ggcaatgccgaagcgacgtatttgctcgccaagaagatgatcgaagccggcgcctgcgcg
ctgcagatcgagaaccaggtttccgacgagaagcaatgcggccaccaggacggcaaggtg
accgttcctcacgaggagttcgtcgccaagatccgggcatgccgctacgcgtttctcgaa
ctcggcgtcgacgacggcatcatcgtcgcgcgaaccgactcgctcggtgcgggcctcacc
aagcagatcgccttcagcgccagcgaaggtgacatcggcgatcaatacaactcgttcctg
gattgcgaggacgtcacggatcaaaagccgtccaatggagacgtcctgatcaccagaggg
tcgagggtcctgcgtccgaagcggctgaggtcaaatctctaccagttccgcgaaggcacg
ggtgctgatcgctgtgtcctggattgcatcaacgcaatcaggaacggcgccgaccttctg
tggatcgagacggagaagccgcatgtcgagcagatcgccggaatgatggaccggatccgc
gacgtcatcccggatgcgaagctcgtctacaacaactctccctcgttcaactggacgctg
aatttccgccagcagatcttcgacgcctggcagaaggacggcaaggacgtctccggcttc
gacagggcgcggctgatgagcgaggagtacgacggcagcgaactggcgcgcgaagccgac
gagcgcatccgcaccttccagcgcgacgcctcgaaacgggccggcatcttccatcacctc
atcaccttgccgacctaccacaccgccgcgctttccaccgacaatcttgccaaggagtac
ttcggcgaccagggcatgctcggctacgtcgccaacgtgcagcgcaaggagatccgccag
ggcatcgcctgcgtgaagcaccagaacatggccggctccgacatcggcgacgaccacaag
gattatttcgccggcgaggccgccctcaaggcgggtggtgagcacaacaccatgaaccag
ttcgccgcctga

DBGET integrated database retrieval system