KEGG   Sinorhizobium fredii NGR234: NGR_c16580Help
Entry
NGR_c16580        CDS       T00888                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rhi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1706923..1707447)
Genome map
AA seq 174 aa AA seqDB search
MSSGKTWRRATLGLGGNIGDPRRAMADALRALDARPDCRVAAVSRLYRTPPWGKTDQNWF
FNACAAVETTRDPEALLETCLEIERTLKRVRKERWGPRTIDIDLLTFDGVILANDKLQLP
HPRMTERGFVLMPLADFAADLEVAGRTVGAWLADADVAGIEVADETADWWRIRE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggtaagacgtggcggcgcgccactctggggctgggtggcaatatcggcgat
ccgcgccgcgccatggcggacgccctgcgggcccttgacgcacggccggactgccgggtc
gcggcggtttcgcggctttaccggacaccgccctggggcaagacggaccagaactggttc
ttcaatgcctgcgcggcggtcgaaaccacgcgcgatccggaagcgttgcttgaaacctgc
ctcgagatcgagaggacattgaagcgcgtccgcaaggagcgctgggggccgcgtacgatc
gacatcgatctcctgaccttcgacggagtgatcctggccaacgacaagctgcaattgccg
catccacgcatgaccgaacgcgggttcgtgctgatgccgcttgccgattttgcggccgac
ctcgaagtagctggcaggacggtcggcgcgtggctggccgatgcggatgtggccggaatc
gaggtcgccgacgagacggccgactggtggcggatccgcgaatga

DBGET integrated database retrieval system