KEGG   Sinorhizobium fredii NGR234: NGR_c16600Help
Entry
NGR_c16600        CDS       T00888                                 

Gene name
folP
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00790  Folate biosynthesis
rhi01100  Metabolic pathways
Module
rhi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NGR_c16600 (folP)
Enzymes [BR:rhi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NGR_c16600 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 7790940
NCBI-ProteinID: YP_002826178
RhizoBase: NGR_c16600
UniProt: C3MDA6
Position
complement(1707802..1708671)
Genome map
AA seq 289 aa AA seqDB search
MTYDPFQKFRWQLAHGRALELGPRGVLMAIINVTPDSFSDGGRFADATAAVAAATRALAD
GAAILDIGGESTRPDADPVDAAEEQARILPVIERLVRETDAIISVDTYRAETARLAVEAG
AHIVNDVHGLQREPAIAEVAAETGAGLCIMHTGRDRQKLDDVVEDQFHFLSRSLQIAGEA
GVTRDRIVLDPGYGFAKDADENLELMARFAELHRFGQPYLVGTSRKRFLGAVTGREAKDR
DAATAVTTGLLRAAGAAVFRVHDVAINRDALAIADAMLIAKNSRRDMKP
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgatccatttcaaaaatttcgttggcagttggcgcatgggcgcgcgttggaa
ctggggccgcgcggtgtcctgatggcgatcatcaatgtcacaccggattccttttccgat
ggcggccgctttgccgatgccacggcggcagtcgcggccgcgacgcgcgccctcgctgac
ggggcggcgatcctggacatcggcggggagtcgacccgccccgacgcggatccagtcgac
gccgcggaggagcaggcgcgcattctgccggtcatcgagagactggtccgcgagacggat
gccattatctcggtcgacacctaccgcgccgaaacggcgcgtctggcggtggaagctggt
gcccatatcgtcaacgacgtgcacggcctgcagcgcgaaccggcgatcgctgaggtcgct
gccgagacgggtgccggactttgcatcatgcatacggggcgcgaccgtcagaagctcgat
gacgtcgtcgaggatcagttccatttcctgagccggtcgttgcagattgccggcgaggca
ggcgtcacgcgcgaccgaatcgtcctggaccctggttatggtttcgccaaggacgcggac
gaaaacctcgaactcatggcgcgtttcgcggaattgcaccggttcggccaaccgtacctg
gtcggtacgtcgcgcaagcgtttcctcggcgccgttaccggccgcgaggcgaaagaccgc
gacgccgctaccgcggtgacgacggggcttctccgagcggccggtgctgcggtctttcgg
gtgcacgatgtcgcaatcaacagggatgcactggcgatcgcggatgctatgctcatcgca
aagaacagccgacgggacatgaagccatga

DBGET integrated database retrieval system