KEGG   Sinorhizobium fredii NGR234: NGR_c17060Help
Entry
NGR_c17060        CDS       T00888                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rhi  Sinorhizobium fredii NGR234
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1764730..1765800
Genome map
AA seq 356 aa AA seqDB search
MQTATSNKTPTPDIAAQITHAMRMMGVAPIPRNYELYYEAYLGSNPQLSKELAALGSRAT
QEDLDAIGARYFSHIHHSRGIERAHSTLAEKLSELVTLLRDEQYALESYNRVLDEAYLNI
ANKSASSADILRHAIDILSEATADTMNQGKERVQTVVQKSVEMEAIRQELDEYKRIANTD
SLTRLGNRRAFDETLAAVYNNEQLRNYTGLLVVDIDHFKKVNDSFGHPVGDKILSTVGTV
IRANLRRDAFVARTGGEEFAVILSDSTQEECMQAADRIRSVLANTPFKNSKTGVNYGPIT
LSVGVCMATAADDPLDLYHKADIALYAAKNSGRNRTVLFEEGMRKDSGRNWLIYRR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcagacggcaacttcgaacaagacgccgacgcccgacatcgctgcgcagatcacccat
gccatgcgtatgatgggcgttgcgccgataccgcgcaattacgagctttactacgaggcc
tatctgggctcgaacccgcaactgtcgaaggaactcgcggcactcggcagccgcgccacg
caggaagaccttgacgccatcggagcgcgttatttcagccatatccaccattcgcgcggg
atcgagcgcgcccacagcacgctggcggaaaagctgtccgaactggttactctgttgcgg
gacgaacaatacgcactcgagagctacaacagggttctcgacgaagcctacctgaacatt
gccaacaagagcgcatcgagcgccgacatcctccgccacgcgatcgacatcctgagtgaa
gcaaccgccgacacgatgaaccagggcaaggagcgggtccagacggtcgttcagaaatca
gtcgagatggaagcgatccgccaggaactcgatgaatacaagcgcatcgccaataccgat
tcgctgacgcgactcggcaatcggcgcgctttcgacgagaccctcgccgcggtctacaac
aatgagcaattgcgcaactacacgggcctgctcgtcgttgacatcgaccacttcaagaag
gtcaacgacagcttcggccatccggtcggcgacaagatcctctccaccgtcggcacggtc
attcgtgcaaatctccggcgggacgccttcgtcgcccgcaccggtggcgaggagtttgcc
gtcatcctgagcgacagcacgcaggaggaatgcatgcaggccgccgaccggatccgcagc
gttctggcaaacacgccgttcaagaactccaagacgggcgtcaactatggtccgatcacc
ctctccgtcggcgtgtgcatggcaacggcggcggacgatccgctcgatctctaccacaag
gccgacatagcgctgtacgcggccaagaattcggggcgcaacaggacggtcctcttcgag
gagggcatgcgcaaggattccggacggaactggctgatctatcgccgctaa

DBGET integrated database retrieval system