KEGG   Sinorhizobium fredii NGR234: NGR_c25210Help
Entry
NGR_c25210        CDS       T00888                                 

Definition
exopolysaccharide production inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NGR_c25210
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     NGR_c25210
Transfer RNA biogenesis [BR:rhi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    NGR_c25210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2615958..2616890
Genome map
AA seq 310 aa AA seqDB search
MGKLRRLRHQPMTKKYDFPGNGFAVDLAGNHRDLESLGMMLESMPCGPKSTGTMLEILER
SAIAAGRAIMEIYNKGPAVTYKPDTSPVTDADHRAERIILDDLAAAFPDLPVVAEEAVAA
GHVPDIAGKRFFLVDPLDGTKEFVERNSHFTVNIALIEDGVPVAGVVHAPALGVIYAGTA
GRAAKAIVEAGRIAGSWQPIECRMASNRPVALISRWHNSAETLAYLDEHAITDCEAIGSS
LKFCLLAEGYADIYPRFSRTMEWDTAAGDAILRAAGGETLLVDGNPFAYGKRNQPNDSDF
ANPWFIARGK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaactgcggcgtctgcgtcatcaacctatgacgaaaaaatatgacttccccggc
aatggttttgcagttgatttggccggaaatcatcgtgatctagaaagcctgggcatgatg
ctcgagtcgatgccgtgtggacccaagagtacaggaacgatgctggagattctggaacga
tcggcgattgcggccggacgggcgatcatggagatctacaataagggcccggcggtgacc
tacaagccggacacctcgccggtgaccgacgcggatcatcgcgccgagcgcatcatcctt
gacgaccttgccgccgcctttcccgatcttcccgtcgtcgccgaggaagccgttgccgcc
gggcatgtccccgacattgccggcaagcgcttctttctcgtcgatcccctcgacggcacc
aaggagttcgtcgagcgcaacagccacttcacggtcaacatcgcgctcatcgaagacggc
gttcccgtcgccggtgtcgtccatgcgccggcgctcggggtgatctatgcgggaactgcc
ggacgggctgccaaggcaatcgtcgaagccggccggatcgcaggatcgtggcagccgatt
gaatgccgcatggcaagcaaccggccagttgcactgatcagccgctggcacaacagcgcc
gaaacgctcgcctaccttgacgaacacgccattaccgactgcgaagccatcggctcgtcg
ctgaagttctgcctgcttgccgaagggtatgccgacatctatccgcgcttcagccgcaca
atggaatgggacacggccgccggcgacgcgatcctacgggcggcgggtggcgaaacgttg
ctggtcgacggcaaccctttcgcctatgggaagcgcaaccagccgaacgacagcgacttc
gccaatccctggttcatcgcgcgcggcaagtag

DBGET integrated database retrieval system