KEGG   Sinorhizobium fredii NGR234: NGR_c25510Help
Entry
NGR_c25510        CDS       T00888                                 

Definition
cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rhi00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rhi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2649577..2649963
Genome map
AA seq 128 aa AA seqDB search
MRIAVVALSFSALFLCPVAGHAQEGDADAGATVFKKCATCHVVDKDQNKVGPSLQGIIGR
TAGTHADFKYSQAMIDAGKGGLVWDEPTLHEYLRNPKAKIKGTKMVFPGLKKDDEIVNVI
AYLKQHPK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgctgttgttgccctgtctttttcggcactctttctctgtccggtggccggc
catgcccaggagggcgatgccgacgcgggagccacggtcttcaagaaatgcgccacctgc
cacgtcgtggacaaggaccagaacaaggtcggtccgtcgctgcagggtatcattggccgg
accgccggcactcatgcggatttcaaatattcgcaagccatgatcgatgccggcaagggc
gggctcgtctgggacgagccgacgctgcacgagtatctgcgcaatcccaaagccaagatc
aaaggcaccaagatggtcttccccggcctcaagaaggacgatgagatcgtcaatgtgatt
gcctatctcaagcaacaccccaaatag

DBGET integrated database retrieval system