KEGG   Sinorhizobium fredii NGR234: NGR_c26660Help
Entry
NGR_c26660        CDS       T00888                                 

Definition
(RefSeq) SAM-dependent methyltransferase protein
Organism
rhi  Sinorhizobium fredii NGR234
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 7790321
NCBI-ProteinID: YP_002827169
RhizoBase: NGR_c26660
UniProt: C3MHR4
Position
2774508..2775455
Genome map
AA seq 315 aa AA seqDB search
MSPSGFLCIRDFGESIVEIIFDQSLVEAHRRRALQGGDAKATFLLDIVAQELADRVAVVE
RHFDKAMELHGYTGATAARLAETGKVGTIERVETDEGFGSSTTPVTVAPLERIPAEAQSL
NLLVSPLSLHLTNDTPGVFIQARRALKPDGLFLAAIPGNGTLQELRESLLAAEAELTGGA
SPRVVPFADVRDMGGLLQRAGFALPVADAETYTVRYDSLFGLLKDLKAMGMGNPLAARSR
RPMPRRFFLRAAEIYAERFSDPDGRIRATFSIIFVSGWAPHESQQKPLKPGSAKQRLSEA
LGASEHALKDSGKPS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgtccccttcagggtttctttgcatccgtgatttcggagagagtatcgtggaaatcatc
tttgaccagagcctcgtcgaggcgcaccgccgccgcgcgctccagggtggcgacgccaag
gcgacctttctgctcgatatcgtcgcccaggagctggccgaccgtgtcgccgtggtggaa
cggcatttcgacaaggccatggaattgcacggctatacgggcgccacggcggcccgcctt
gccgagaccggcaaggtcggcaccattgagcgggtggaaacggacgaaggcttcggatcg
tccactactccggttaccgtggccccgctcgagcgcatcccggccgaagcgcaatctctc
aatctgctggtgtcgccgctgtcgctgcatctgaccaacgacacgcccggcgtcttcatc
caggcgcgccgcgccctgaagccggacgggctgttccttgccgcgatcccgggcaacggc
acgctgcaggagcttcgcgaatcgctgctggcggccgaagcggaactgaccggcggggca
agcccaagggtggttccctttgccgacgtgcgcgacatgggcgggcttctgcagcgggcg
ggatttgccctgccggtcgccgatgccgagacctacacggttcgctacgattcgctcttc
gggctgctcaaggacctgaaggcgatggggatgggcaacccgctcgcagcgcgaagccgc
aggccgatgccacgccgcttcttcctgagagcggccgaaatctatgcggagcgcttttcc
gacccggacggccggatccgcgcgaccttctcgatcatcttcgtctcgggctgggcaccg
cacgaaagccagcaaaagccgctgaagccgggatcggcgaagcagaggctgtcggaagcg
ctcggggcaagcgagcacgcgctgaaggattcggggaagccgtcttga

DBGET integrated database retrieval system