KEGG   Sinorhizobium fredii NGR234: NGR_c26750Help
Entry
NGR_c26750        CDS       T00888                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00010  Glycolysis / Gluconeogenesis
rhi00620  Pyruvate metabolism
rhi00640  Propanoate metabolism
rhi00680  Methane metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_c26750
   00620 Pyruvate metabolism
    NGR_c26750
   00640 Propanoate metabolism
    NGR_c26750
  Energy metabolism
   00680 Methane metabolism
    NGR_c26750
Enzymes [BR:rhi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NGR_c26750
Lipid biosynthesis proteins [BR:rhi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NGR_c26750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 7790330
NCBI-ProteinID: YP_002827178
RhizoBase: NGR_c26750
UniProt: C3MHS3
Position
complement(2785719..2787368)
Genome map
AA seq 549 aa AA seqDB search
MLPKIETYEELYREFRWRIPERFNIGVAVSDDWAARDPERVCLQHFSPDGAHRSLTYGAF
AARSSAFAGGLAARGIKPGDRVAILLPQGFEVAIAHAAIYKLGAIALPLALLFGVEALSY
RLQDAGATAIVTNRFGYERLAAIRDGLPELRLVVLAEEEELPGTVRFGDLAAGEGRFLAA
DTGPDDPALMIYTSGTTGPPKGALHGHRVLLGHLPGFQFHHHFLPQPGDRMWTPADWAWA
GGLLNALLPSLYFGVPVVSSPAQKFDPHMAFRIMEEMDVRNAFIPPTALRLLKAVECPRA
RYRLNLRTIGSAGEALGRETFEWAKEALGIEVSEFYGQTECNIVISSAADLGALKPGSMG
KAAPGHAVAIIDGEGRVLPPGTTGQVAVRRPDPVMFLGYWRNNRATEAKFIGDWMTTGDQ
GVMDAEGYFTFFGRDDDVITSSGYRIGPGEIEDCLVGHPDVQMAAAIGKPDPIRTEIVKA
YVVLKPGVAASDEIAAAIRGWVKNRLSMHEYPREIEFVDSLPLTTSGKVIRRLLRERAAA
EATEAARER
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgctaccgaagatcgagacctacgaggaactctatcgcgaattccgctggcgaattccg
gagaggttcaatatcggcgtcgccgtcagcgacgattgggcggcgcgggatccggagcgt
gtctgccttcagcatttcagcccggacggcgcgcatcgttcgctgacctacggagctttt
gccgcccgttcctcggcctttgccggtggactcgccgcgcgcggcatcaaaccgggggat
cgtgtcgccatcctgctgccgcaggggttcgaggtggcgatcgcgcatgcggcgatctac
aagctcggggcgatcgccctgccgctggcgctgctcttcggcgtcgaggcgctcagctat
cggctgcaggatgcgggggcgacggcgatcgtcaccaatcgcttcggctatgaaaggctt
gcggcgatccgggacggactgccggagcttcggctcgtggttctggcggaagaggaggaa
ctgcccgggacggtgcgattcggcgatcttgccgcgggcgagggccgcttcctcgctgcc
gataccggtccggacgatccggcgctgatgatctatacgtcggggacgaccgggccgccg
aagggcgccctgcacggccaccgcgtgctgctcggccatctgccgggcttccagttccac
catcatttcctgcctcagccgggcgaccggatgtggacgccggccgactgggcctgggca
ggcggcctcttgaacgcgctgctgccgtcgctctacttcggcgtgccggtggtttcctcg
cccgcccagaagttcgatccgcacatggccttccggatcatggaagagatggacgtgcgc
aacgccttcattcctccgacggcgctgaggctcttgaaagcagtggaatgcccgcgcgcc
cgctaccggctcaatctgaggacgatcggctcggcgggggaggcgctcgggcgcgagacc
ttcgaatgggcgaaagaggcgctcggcatcgaagtcagcgaattctatggccagacggaa
tgcaacatcgtcatctcgtcggccgccgatctcggcgcgctgaagcccggttcgatgggc
aaggcagcgccgggccacgcggtggcgatcatcgacggcgaggggcgcgtgctgccgccg
gggacgacgggccaagtcgccgtcaggcgccccgatccggtgatgttcctcggctattgg
cgaaacaacagggcgaccgaggcgaagttcatcggcgactggatgacgaccggcgaccag
ggcgtgatggatgccgaaggctacttcacctttttcggccgggatgacgacgtcatcacc
tcgtccggctaccgcatcggcccgggtgagatcgaggattgcctggtggggcacccggac
gtccagatggccgcggcgatcggcaagccggatccgatccgcaccgagatcgtcaaggcc
tatgtggtgctgaagcccggtgtcgccgccagcgacgagatcgcggcggcgatccgcggc
tgggtgaagaaccggctctccatgcacgaatatccgcgcgagatcgagttcgtcgacagc
ctgccgctcaccacctcgggcaaggtgatccggcggctgctacgggaacgggcggctgct
gaagcgacggaggcagcgcgcgagcgttga

DBGET integrated database retrieval system