KEGG   Sinorhizobium fredii NGR234: NGR_c26770Help
Entry
NGR_c26770        CDS       T00888                                 

Definition
(RefSeq) alcohol dehydrogenase, GroES-like protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00010  Glycolysis / Gluconeogenesis
rhi00071  Fatty acid degradation
rhi00350  Tyrosine metabolism
rhi00625  Chloroalkane and chloroalkene degradation
rhi00626  Naphthalene degradation
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_c26770
  Lipid metabolism
   00071 Fatty acid degradation
    NGR_c26770
  Amino acid metabolism
   00350 Tyrosine metabolism
    NGR_c26770
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NGR_c26770
   00626 Naphthalene degradation
    NGR_c26770
Enzymes [BR:rhi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NGR_c26770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 7790332
NCBI-ProteinID: YP_002827180
RhizoBase: NGR_c26770
UniProt: C3MHS5
Position
2788508..2789536
Genome map
AA seq 342 aa AA seqDB search
MAQTMKAAVVRQFRAPLTIEEMAVPTPGAGQILVKYEATGVCHTDLHAANGDWPVKPSPP
FIPGHEGVGFVSAVGAGVKRVKEGDRVGVPWLHTACGYCPYCRTGWETLCASQSNTGYSV
NGTFAEFGLADPEFVGRLPDELEFGAAAPVLCAGVTVYKGLKETEVRPGEWVAVSGVGGL
GHMAVQYAKAMGMHVVAADIFEDKLALAKQLGADIAINGKAEDAIEKVKKATNGGVHGVL
VTAVSPAAMEQAFGFMRSKGTMALVGLPPGKIALPVFETVLKRITVRGSIVGTRQDLEEC
LQFAAEGKVKPHFSWENLESINDIFHRMEAGKIDGRIVMRLQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcacagacaatgaaggcggctgtcgttcgacagttccgcgctccgctgaccatcgag
gagatggcggttccaactcctggagcggggcagatcctcgtgaaatatgaagcgacgggc
gtgtgtcataccgacctgcatgcggcaaacggcgattggccggtgaagccgagcccgccc
ttcattccagggcacgagggtgttggcttcgtctcagccgtgggcgccggcgtgaagaga
gtgaaggaaggtgaccgggttggagtgccgtggctccataccgcttgcggctattgtccc
tattgccggaccggctgggaaacgctgtgcgcttcgcaatcgaacaccggatactcggtg
aacggcacgttcgcggaattcgggctggcggatcccgagttcgtcggcaggcttcccgat
gaattggaattcggagctgccgctcccgttctctgcgcgggagtgaccgtctacaagggt
ctgaaggaaacggaagtccgccccggcgaatgggtggccgtctcgggcgtcggcggtctg
ggccacatggcggtgcaatatgccaaggcgatgggcatgcacgtggtcgccgccgacata
ttcgaagacaagctggcgctcgccaagcaacttggcgctgacatagcgataaacggcaag
gcagaggatgccattgaaaaggtaaagaaggccacgaatggtggcgttcacggcgtactc
gtgaccgccgtctcccccgccgccatggaacaggccttcggcttcatgcggtcaaagggc
acgatggccctcgtcggcctgccgcccggaaagatagcgctgccagttttcgaaaccgtg
ttgaagcgcatcaccgtacgcggctctatcgtcggcacgcgccaggacctggaagaatgc
ctgcagttcgccgcggaaggcaaggtaaagccgcatttctcctgggagaacctggagagc
atcaacgacatcttccatcgcatggaagcgggcaagatcgacggtcgcatcgtcatgcga
ctgcaatag

DBGET integrated database retrieval system