KEGG   Sinorhizobium fredii NGR234: NGR_c26770Help
Entry
NGR_c26770        CDS       T00888                                 

Definition
alcohol dehydrogenase, GroES-like protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NGR_c26770
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_c26770
  Lipid metabolism
   00071 Fatty acid degradation
    NGR_c26770
  Amino acid metabolism
   00350 Tyrosine metabolism
    NGR_c26770
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NGR_c26770
   00626 Naphthalene degradation
    NGR_c26770
Enzymes [BR:rhi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NGR_c26770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2788508..2789536
Genome map
AA seq 342 aa AA seqDB search
MAQTMKAAVVRQFRAPLTIEEMAVPTPGAGQILVKYEATGVCHTDLHAANGDWPVKPSPP
FIPGHEGVGFVSAVGAGVKRVKEGDRVGVPWLHTACGYCPYCRTGWETLCASQSNTGYSV
NGTFAEFGLADPEFVGRLPDELEFGAAAPVLCAGVTVYKGLKETEVRPGEWVAVSGVGGL
GHMAVQYAKAMGMHVVAADIFEDKLALAKQLGADIAINGKAEDAIEKVKKATNGGVHGVL
VTAVSPAAMEQAFGFMRSKGTMALVGLPPGKIALPVFETVLKRITVRGSIVGTRQDLEEC
LQFAAEGKVKPHFSWENLESINDIFHRMEAGKIDGRIVMRLQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcacagacaatgaaggcggctgtcgttcgacagttccgcgctccgctgaccatcgag
gagatggcggttccaactcctggagcggggcagatcctcgtgaaatatgaagcgacgggc
gtgtgtcataccgacctgcatgcggcaaacggcgattggccggtgaagccgagcccgccc
ttcattccagggcacgagggtgttggcttcgtctcagccgtgggcgccggcgtgaagaga
gtgaaggaaggtgaccgggttggagtgccgtggctccataccgcttgcggctattgtccc
tattgccggaccggctgggaaacgctgtgcgcttcgcaatcgaacaccggatactcggtg
aacggcacgttcgcggaattcgggctggcggatcccgagttcgtcggcaggcttcccgat
gaattggaattcggagctgccgctcccgttctctgcgcgggagtgaccgtctacaagggt
ctgaaggaaacggaagtccgccccggcgaatgggtggccgtctcgggcgtcggcggtctg
ggccacatggcggtgcaatatgccaaggcgatgggcatgcacgtggtcgccgccgacata
ttcgaagacaagctggcgctcgccaagcaacttggcgctgacatagcgataaacggcaag
gcagaggatgccattgaaaaggtaaagaaggccacgaatggtggcgttcacggcgtactc
gtgaccgccgtctcccccgccgccatggaacaggccttcggcttcatgcggtcaaagggc
acgatggccctcgtcggcctgccgcccggaaagatagcgctgccagttttcgaaaccgtg
ttgaagcgcatcaccgtacgcggctctatcgtcggcacgcgccaggacctggaagaatgc
ctgcagttcgccgcggaaggcaaggtaaagccgcatttctcctgggagaacctggagagc
atcaacgacatcttccatcgcatggaagcgggcaagatcgacggtcgcatcgtcatgcga
ctgcaatag

DBGET integrated database retrieval system