KEGG   Sinorhizobium fredii NGR234: NGR_c28650Help
Entry
NGR_c28650        CDS       T00888                                 

Gene name
exoN
Definition
(RefSeq) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00040  Pentose and glucuronate interconversions
rhi00052  Galactose metabolism
rhi00500  Starch and sucrose metabolism
rhi00520  Amino sugar and nucleotide sugar metabolism
rhi01100  Metabolic pathways
rhi01130  Biosynthesis of antibiotics
Module
rhi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NGR_c28650 (exoN)
   00052 Galactose metabolism
    NGR_c28650 (exoN)
   00500 Starch and sucrose metabolism
    NGR_c28650 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    NGR_c28650 (exoN)
Enzymes [BR:rhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NGR_c28650 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-GeneID: 7790518
NCBI-ProteinID: YP_002827364
RhizoBase: NGR_c28650
UniProt: C3MIP8
Position
complement(2990884..2991771)
Genome map
AA seq 295 aa AA seqDB search
MTEKRKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEALEAGIEHLIFVT
GRSKAVIEDYFDIQVELDQTLRERNKKAEIELLEAILPKAGTTSFTRQQAPLGLGHAVWC
ARDLVGNEPFALLLPDMIMKGEKGCLKGMVDLYEHSGGNVVAVEECAPEQAHKYGIVGVG
DRVGDGFKITKMVEKPARGTAPSNFFINGRYILQPEIFPILERQERGAGNEIQLTDGMVK
LAEAQAFAAYHFRGETFDCGAKDGFILANVAFALERADIRPTVEGPLKTLLQGLK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaagcgtaaagtccgcaaagccgtcttccccgttgccgggctggggacacgt
tttcttcccgccaccaaggcggtgccgaaggaaatgctgacggtcgtggacaagccggtc
atccagtatgtcgtcgacgaggcactggaagcggggatcgagcacctgatcttcgtcacc
ggccgcagcaaggcggttatcgaggactatttcgacattcaggtcgagctcgaccagacg
ctcagagaacgcaacaagaaagccgaaatcgagctgctcgaagcgatactgccgaaggcc
gggacgacgagtttcacccgccagcaggcaccgctcggcctcggccacgcggtctggtgc
gcgcgcgatctggtcggcaacgagcccttcgcactgcttctccccgacatgatcatgaag
ggtgaaaagggctgcctgaaaggcatggtcgacctctacgaacacagcggcggcaatgtc
gtcgccgtcgaggaatgcgcccccgagcaggcgcacaaatacggcatcgtcggcgtcggc
gatagggtcggcgacggcttcaagatcaccaagatggtcgagaagccggcccggggcacg
gcgccgtccaatttcttcatcaacggccgctatatcctgcagccggaaatcttcccgatt
ctggagcgccaggagcgcggcgccggcaacgagatccagctgaccgacgggatggtgaag
cttgccgaggcacaggctttcgccgcctatcatttccgcggcgagaccttcgactgcggg
gcgaaggacggcttcatcctcgccaacgtcgccttcgccctcgagcgcgccgacattcgc
ccgaccgtcgaggggccgctcaagacgctgctgcaaggattgaagtag

DBGET integrated database retrieval system