KEGG   Sinorhizobium fredii NGR234: NGR_c28720Help
Entry
NGR_c28720        CDS       T00888                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NGR_c28720
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NGR_c28720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3004342..3005325
Genome map
AA seq 327 aa AA seqDB search
MTTILHPTPDNPIPGKPQVGFFDGAGGRKIRYAVFKANAPATRGTIVLLQGRNESIEKYF
ETIGDLTAAGFWVATFDWRGQGGSERLLPQPGRGHVEHFADYERDLTIFLEQIVLPDTRL
PFSIVAHSMGALVALSLAPMLASRIDRMVLLAPFLGLSGQAIGERGIVAIATVMRWFGLG
SLPVRRDKERQSPFRNNPLTSDSRRYQRNLALIDARPHLRIGPPTGRWLSESFRAIRRAM
RREHLTKVIVPTVILAPTADALVPYLAMEFLASNFRAGHLIPIDGARHELFQEADRYRAQ
ALAAILAFLPEADAEAAELPPRTMEDA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatccttcatcccacgccggacaatccgatcccgggcaagccgcaagtgggc
tttttcgacggcgccggcggccgcaagatccgctatgcggtgttcaaggcgaacgcgccg
gcgacgcgcggcacgatcgtgctcttgcaggggcgcaacgagtcgatcgagaaatacttc
gaaacgatcggcgacctcaccgcggcgggattctgggtcgccactttcgactggcgcggc
cagggcggatccgagcggctcttgccgcagccgggccgcggccacgtggagcattttgcc
gattacgagcgcgacctcacgatcttcctcgaacagatcgtcctaccggacacgcgcctg
cctttctccatcgtcgcccattcgatgggcgctttggtcgccctgtcgctggcgccgatg
ctggcaagccgcatcgaccgcatggtgctgcttgcccccttcctgggcctgagcggccag
gcgatcggcgagcgcggcatcgtggcgattgccaccgtcatgcgctggttcggcctcggc
agcctgccggtgcgccgcgacaaggaacgccagtcccccttcaggaacaatccgctcacc
tccgacagccggcgttatcagcgcaacctggccttgatcgacgcccgtccgcatttgcgg
atcgggccgccgacgggccggtggttgagcgagtcgttcagagcgatcaggcgcgcgatg
cgccgcgagcacctgacgaaggtcatcgtcccgaccgtcatcctggcgccgacggccgac
gctctcgtgccctatctcgcgatggaatttctcgccagcaatttccgcgccgggcatctg
atcccgatcgatggcgcccgccacgagctctttcaggaggccgaccgctaccgcgcccag
gcgctcgcggcgatcctggccttccttccggaggcggatgccgaggcggccgagcttccg
ccacgcaccatggaggatgcctag

DBGET integrated database retrieval system