KEGG   Sinorhizobium fredii NGR234: NGR_c30680Help
Entry
NGR_c30680        CDS       T00888                                 

Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00900  Terpenoid backbone biosynthesis
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NGR_c30680
Enzymes [BR:rhi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     NGR_c30680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-GeneID: 7792339
NCBI-ProteinID: YP_002827556
RhizoBase: NGR_c30680
UniProt: C3M9M8
Position
3215828..3217003
Genome map
AA seq 391 aa AA seqDB search
MASGDESKRRLTILGSTGSIGTNTLDVVERLGGRNRFEIAALTGNGNIPLLADQARRMGA
ELAVTADEHRYGELKDALGGSGIEVAAGRSGLIEAAERDAGWLMAAIVGNAGLGPTLAAA
RRGADIALANKECLVSAGSLFIEAVAKGGGRLLPVDSEHNAIFQVLENDQRHAVERIILT
ASGGPFRTKSLEEMRHVTADIARAHPNWSMGLKISIDSASMFNKALEMIEARHLFRLRPD
QIEVIVHPQSVIHSMVGYSDGSVLAQLGCPDMRTAIGYALTYPKRCDLPIERLDFAKLAR
LDFEAPDEARFPALRLARRAMQAGGIQGAVLNGAKETALEAFIKGRIGFLAMAEIVEKVM
DRLSDLPAAVTMDDVFAADEKARLTAAGLIQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcatccggcgacgagagcaagcgccgtctgacgatactgggctccaccgggtcgatc
ggaaccaacacgctcgacgtcgtcgagcggctcggcgggcgcaaccgtttcgaaatcgct
gccctgacgggcaatggcaacataccgctcctcgccgaccaggcgcggcggatgggtgcg
gaactggccgtaaccgccgacgaacaccgctacggcgaactcaaggatgcgcttggcggc
agcggcatcgaagtggccgccgggcggagcggcctgatcgaggcggccgaacgggatgcc
ggctggctgatggcggcgatcgtcggcaatgcggggctcggccccacgcttgcggctgcc
cgtcgcggcgccgatatagcgcttgccaacaaggaatgtctcgtctccgccggcagcctg
ttcatcgaggcggtcgccaagggcggaggccggctgctgccggtcgacagcgagcacaat
gcgatcttccaggtcctggagaacgaccagcgtcacgccgtcgagcgcatcatcctgacc
gcgtcgggcggcccgttccgcaccaagtcgctcgaggagatgcggcatgtgacggccgac
atagcgcgcgcccatccgaactggtcgatgggcctgaaaatctcgatcgacagcgcttcg
atgttcaacaaggcactggaaatgatcgaggcgcgccatctctttcgcctgcgccccgac
cagatcgaggtgatcgtccatccgcagtcggtcatccattcgatggtcggctacagcgac
ggatcggtgcttgcgcagctcggctgccccgacatgcggacggcgatcggctatgcgctc
acctatccgaagcgctgcgatctgccgatcgagcggctcgacttcgccaagctcgcccgg
ctcgatttcgaggcgccggacgaggcgcgcttcccggctctccgcctggcgcgtcgcgcc
atgcaggcgggtggcattcagggcgcggtgctgaacggcgccaaggagacggcgctggag
gccttcatcaagggccgcatcggcttccttgccatggcggagatcgtcgagaaggtgatg
gacaggctctccgacctgccggccgccgtgacgatggacgacgtcttcgccgccgacgaa
aaagcccggctgacggctgccgggctcattcaatag

DBGET integrated database retrieval system