KEGG   Sinorhizobium fredii NGR234: NGR_c30680Help
Entry
NGR_c30680        CDS       T00888                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:rhi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3215828..3217003
Genome map
AA seq 391 aa AA seqDB search
MASGDESKRRLTILGSTGSIGTNTLDVVERLGGRNRFEIAALTGNGNIPLLADQARRMGA
ELAVTADEHRYGELKDALGGSGIEVAAGRSGLIEAAERDAGWLMAAIVGNAGLGPTLAAA
RRGADIALANKECLVSAGSLFIEAVAKGGGRLLPVDSEHNAIFQVLENDQRHAVERIILT
ASGGPFRTKSLEEMRHVTADIARAHPNWSMGLKISIDSASMFNKALEMIEARHLFRLRPD
QIEVIVHPQSVIHSMVGYSDGSVLAQLGCPDMRTAIGYALTYPKRCDLPIERLDFAKLAR
LDFEAPDEARFPALRLARRAMQAGGIQGAVLNGAKETALEAFIKGRIGFLAMAEIVEKVM
DRLSDLPAAVTMDDVFAADEKARLTAAGLIQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcatccggcgacgagagcaagcgccgtctgacgatactgggctccaccgggtcgatc
ggaaccaacacgctcgacgtcgtcgagcggctcggcgggcgcaaccgtttcgaaatcgct
gccctgacgggcaatggcaacataccgctcctcgccgaccaggcgcggcggatgggtgcg
gaactggccgtaaccgccgacgaacaccgctacggcgaactcaaggatgcgcttggcggc
agcggcatcgaagtggccgccgggcggagcggcctgatcgaggcggccgaacgggatgcc
ggctggctgatggcggcgatcgtcggcaatgcggggctcggccccacgcttgcggctgcc
cgtcgcggcgccgatatagcgcttgccaacaaggaatgtctcgtctccgccggcagcctg
ttcatcgaggcggtcgccaagggcggaggccggctgctgccggtcgacagcgagcacaat
gcgatcttccaggtcctggagaacgaccagcgtcacgccgtcgagcgcatcatcctgacc
gcgtcgggcggcccgttccgcaccaagtcgctcgaggagatgcggcatgtgacggccgac
atagcgcgcgcccatccgaactggtcgatgggcctgaaaatctcgatcgacagcgcttcg
atgttcaacaaggcactggaaatgatcgaggcgcgccatctctttcgcctgcgccccgac
cagatcgaggtgatcgtccatccgcagtcggtcatccattcgatggtcggctacagcgac
ggatcggtgcttgcgcagctcggctgccccgacatgcggacggcgatcggctatgcgctc
acctatccgaagcgctgcgatctgccgatcgagcggctcgacttcgccaagctcgcccgg
ctcgatttcgaggcgccggacgaggcgcgcttcccggctctccgcctggcgcgtcgcgcc
atgcaggcgggtggcattcagggcgcggtgctgaacggcgccaaggagacggcgctggag
gccttcatcaagggccgcatcggcttccttgccatggcggagatcgtcgagaaggtgatg
gacaggctctccgacctgccggccgccgtgacgatggacgacgtcttcgccgccgacgaa
aaagcccggctgacggctgccgggctcattcaatag

DBGET integrated database retrieval system