KEGG   Sinorhizobium fredii NGR234: NGR_c30820Help
Entry
NGR_c30820        CDS       T00888                                 

Gene name
arcA1
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGR_c30820 (arcA1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NGR_c30820 (arcA1)
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     NGR_c30820 (arcA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3236092..3237015
Genome map
AA seq 307 aa AA seqDB search
MKSITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLSELGHTVHDEGDLRPLPARDLPNH
AGANNLQMVAAFARALNDTVHDTARKGHVPIILGGDHALSMGSVSGMARYAHEVGRPLFV
LWLDAHADFNSPSTSPSGNMHGMPVAFFCGEAEFTPILAADRPLVDPKRVYQVGIRSVDS
REREEIAEHGVNVYDMRAVDEIGMAHIMRQILDDVRAADGLLHVSLDVDFMDPEFAPGVG
TTVPGGATFREAHLIMEMLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL
DRPTRSA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcattacgttgatcggcgcacccatcgaggaaggttccgggcgccgcggcgcg
gccatgggcccgacggcgctgaggattgccggcatcgacacggtgctttccgaattgggc
catacggttcacgacgaaggcgacctgcggccactgccggcccgcgaccttccgaaccat
gcgggcgcgaacaatctgcagatggtcgccgccttcgcccgggcgctcaacgacacggta
catgacacggcccgcaagggacatgtcccgatcattctcggcggcgatcatgccctgtcg
atgggcagcgtctccggcatggcgcgctacgcgcacgaggtcggccggccgctcttcgtg
ctctggctcgacgcccacgccgacttcaactcgccttcgacgtcgccatccggcaacatg
cacggcatgccggttgccttcttctgcggcgaagcggaattcaccccgattctcgccgca
gatcggccgctcgtcgatccgaaaagggtctaccaggtcggtatccgttcggtcgattca
cgcgaacgcgaggagatcgccgagcacggcgtcaatgtctacgacatgcgggccgtcgac
gagataggcatggcccatatcatgcggcagatcctcgacgacgtgcgcgccgccgacggc
ctcttgcatgtcagcctcgacgtcgatttcatggatccggagtttgcccccggcgtcggc
accaccgtgccgggcggcgccaccttccgcgaggcccatctcatcatggagatgctttgc
gacagcggtctcgtctcttcgctcgacgtcgtcgaactcaacccgttcctcgacgaccgc
ggcaagagcgcccgcatactggtggagctgacggcgagcctcttcggccgccgcatcctt
gaccggccgacccggagcgcctga

DBGET integrated database retrieval system