KEGG   Sinorhizobium fredii NGR234: NGR_c31710Help
Entry
NGR_c31710        CDS       T00888                                 

Gene name
proB
Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00330  Arginine and proline metabolism
rhi00332  Carbapenem biosynthesis
rhi01100  Metabolic pathways
rhi01130  Biosynthesis of antibiotics
rhi01230  Biosynthesis of amino acids
Module
rhi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NGR_c31710 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NGR_c31710 (proB)
Enzymes [BR:rhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NGR_c31710 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 7792441
NCBI-ProteinID: YP_002827658
RhizoBase: NGR_c31710
UniProt: C3M9Y0
Position
3332075..3333256
Genome map
AA seq 393 aa AA seqDB search
MAATVRPLEKYRRIVIKIGSALLVDRKSGLKKSWLDAMCVDIAALKAKGVEVLVVSSGAI
ALGRTVLNLPAGALKLEESQAAAAVGQIALARAWSESLSTDQIIAGQILLTLGDTEERRR
YLNARATINQLLKLGSVPIINENDTVATTEIRYGDNDRLAARVATMVGADLLVLLSDIDG
LYTAPPHLDPQARFLETIAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTAGCAMII
ASGKPEHPLKAIEAGARSSWFAPSGSPVTARKTWIAGQLLPAGSIAIDAGAETALRSGKS
LLPAGVRQVTGTFSRGDTIAILNASGREIARGLAGYDADDARQIAGKKSAEIAAILGYAG
RTAMVHRDDMVMTAPSGARSEEGGNEKKGKLHA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgaccgtcagaccgctcgaaaaataccgccggatcgtcatcaagatcggctcg
gccctgctggtcgaccgcaagagcgggctgaagaagagctggctcgacgccatgtgtgtc
gatatcgcggcgctgaaggcgaagggcgtcgaggtgctggtcgtctcctcgggtgccatc
gcgctcggccgcaccgtgctcaacctgccggccggcgccttgaaactcgaggaaagccag
gcggcagcggcggtcggccagatcgccctggcgcgcgcctggtcggaaagcctctctacc
gatcagatcatcgccggccagatcctcttgacgctcggcgatacggaggagcgccgccgc
tatttgaatgcgcgcgccacgatcaaccagctcttgaagctcggctccgtgccgatcatc
aacgagaacgacacggtcgccaccaccgagatccgctatggcgacaacgaccggctcgcg
gcccgcgtggcgacgatggtcggcgccgacctgctcgtgctgttgtccgacatcgacggg
ctctacacggctccgccgcatcttgatccgcaggcgcgcttcctcgagacgatcgccgag
attaccccggagatcgaggcgatggcaggcggcgccgcctccgagctgtcgcgcggcggc
atgcgcaccaagatcgatgccggcaagatcgccaccactgccggctgcgcgatgatcatt
gcctccggcaagccggagcatccgctgaaggcgatcgaggcgggcgcccgctcctcctgg
ttcgcgccttccggctcgccggtgacggcgcgcaagacctggatcgccggccagctcctg
ccggcaggatcgattgcgatcgacgccggcgcggagacggcgctgcgctccggcaagagc
ctgctgcccgccggtgtccgacaggtgacgggaacgttcagccgcggcgacaccattgcg
atcctcaacgcttccggccgcgagatcgcccgcggccttgccggctacgacgccgacgac
gcccgccagatcgccggcaagaaatcggccgagatcgccgcgatcctcggctatgcgggc
cgcaccgccatggtgcatcgcgacgatatggtgatgacggccccctccggcgcgcgatcc
gaagaggggggaaatgagaagaagggcaagctccatgcttga

DBGET integrated database retrieval system