KEGG   Sinorhizobium fredii NGR234: NGR_c31710Help
Entry
NGR_c31710        CDS       T00888                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGR_c31710 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NGR_c31710 (proB)
Enzymes [BR:rhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NGR_c31710 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3332075..3333256
Genome map
AA seq 393 aa AA seqDB search
MAATVRPLEKYRRIVIKIGSALLVDRKSGLKKSWLDAMCVDIAALKAKGVEVLVVSSGAI
ALGRTVLNLPAGALKLEESQAAAAVGQIALARAWSESLSTDQIIAGQILLTLGDTEERRR
YLNARATINQLLKLGSVPIINENDTVATTEIRYGDNDRLAARVATMVGADLLVLLSDIDG
LYTAPPHLDPQARFLETIAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTAGCAMII
ASGKPEHPLKAIEAGARSSWFAPSGSPVTARKTWIAGQLLPAGSIAIDAGAETALRSGKS
LLPAGVRQVTGTFSRGDTIAILNASGREIARGLAGYDADDARQIAGKKSAEIAAILGYAG
RTAMVHRDDMVMTAPSGARSEEGGNEKKGKLHA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgaccgtcagaccgctcgaaaaataccgccggatcgtcatcaagatcggctcg
gccctgctggtcgaccgcaagagcgggctgaagaagagctggctcgacgccatgtgtgtc
gatatcgcggcgctgaaggcgaagggcgtcgaggtgctggtcgtctcctcgggtgccatc
gcgctcggccgcaccgtgctcaacctgccggccggcgccttgaaactcgaggaaagccag
gcggcagcggcggtcggccagatcgccctggcgcgcgcctggtcggaaagcctctctacc
gatcagatcatcgccggccagatcctcttgacgctcggcgatacggaggagcgccgccgc
tatttgaatgcgcgcgccacgatcaaccagctcttgaagctcggctccgtgccgatcatc
aacgagaacgacacggtcgccaccaccgagatccgctatggcgacaacgaccggctcgcg
gcccgcgtggcgacgatggtcggcgccgacctgctcgtgctgttgtccgacatcgacggg
ctctacacggctccgccgcatcttgatccgcaggcgcgcttcctcgagacgatcgccgag
attaccccggagatcgaggcgatggcaggcggcgccgcctccgagctgtcgcgcggcggc
atgcgcaccaagatcgatgccggcaagatcgccaccactgccggctgcgcgatgatcatt
gcctccggcaagccggagcatccgctgaaggcgatcgaggcgggcgcccgctcctcctgg
ttcgcgccttccggctcgccggtgacggcgcgcaagacctggatcgccggccagctcctg
ccggcaggatcgattgcgatcgacgccggcgcggagacggcgctgcgctccggcaagagc
ctgctgcccgccggtgtccgacaggtgacgggaacgttcagccgcggcgacaccattgcg
atcctcaacgcttccggccgcgagatcgcccgcggccttgccggctacgacgccgacgac
gcccgccagatcgccggcaagaaatcggccgagatcgccgcgatcctcggctatgcgggc
cgcaccgccatggtgcatcgcgacgatatggtgatgacggccccctccggcgcgcgatcc
gaagaggggggaaatgagaagaagggcaagctccatgcttga

DBGET integrated database retrieval system