KEGG   Sinorhizobium fredii NGR234: NGR_c31990Help
Entry
NGR_c31990        CDS       T00888                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NGR_c31990
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    NGR_c31990
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NGR_c31990
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NGR_c31990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3360086..3361645
Genome map
AA seq 519 aa AA seqDB search
MADIRSTLTRRSFLLSGGAAGLAASSGLATPFYARGYGRPEFLHGVQSGDVDPQSGMIWT
RVDRPARVAVEYSTTESFSTAIRLPDIDVTPQTDCAVKCQLDKLLPDQDIFYRFTATDLY
DANRVSEPIVGRFRTAPLRRRSVRFAWSGDTAGQGWGIDEVGMKTYSTMRLHEPDFFIHS
GDTIYADNPIPDEIKLRDGGMWKNRIVTAEKRDVARTLGEYRGQWKYNLLDEHVRGLNAV
CPTFYQWDDHEVLNNWSASTDLRDDPRYPEKDVTVYAARAARAFHEMTPIRTLPTQPGRI
FRKIAYGPLLDVFFVDLRSYRGPNQGGEAGLFGWRQMDWLKRALAASRATWKVIACDMPI
GLVVWDDYSRKRGSDAIANGDNGAPGGRETEFADLLRFIRDNAIDNIVWLTADVHYTAAH
HYDPSRAAFKDFLPFWEFVSGPLHSGTYGPKELDMTFGPQVRFIKASAGGIDSNLPPSAG
LQFFGIVDINGQTEQLTVRLMDRQDQELWRVTLDPAAVA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
ttggctgacattcgaagcacgcttaccaggcgttcttttctcctatccggcggcgctgcc
ggccttgccgcttcttccggccttgcgacccctttctatgcgcgcggctacgggcggccg
gaattcctgcacggcgtgcagtccggcgatgtcgatccgcaatcggggatgatctggacg
cgggtcgatcgtccggcccgcgtcgcggtcgaatattcgaccaccgaaagcttctcgacc
gccatccggctccccgacatcgacgtgacgccgcagacggattgcgcggtgaagtgccag
ctcgacaaactcctgccggaccaggacatcttctatcgcttcaccgcgaccgatctctat
gacgccaatcgcgtttccgagccgatcgtcgggcgcttccgcaccgcgcccttgcggcga
cgttcggtacgcttcgcctggtccggcgacacggccggccagggctggggcatcgacgag
gtcggcatgaagacctattcgaccatgcgcctgcacgagccggatttcttcatccattcc
ggcgacacgatctatgccgacaatccgatccccgacgagatcaagctacgtgacggtggc
atgtggaagaaccggatcgtcacggccgagaagcgcgacgtcgcccgcacgcttggcgaa
tatcgcggccagtggaaatacaatctgctcgacgagcatgtgcggggcttgaacgccgtc
tgcccgactttctatcaatgggacgaccacgaggtcctgaacaattggtcggcctccacc
gatcttcgcgacgatccgcgctatccggagaaggatgtaacggtctatgcggcccgtgcg
gcgcgcgccttccatgagatgacgccgatccgcacgctgccgacgcagccggggcggatc
ttccgcaagatcgcctatggaccgctgcttgacgtgttcttcgtcgacctgcgctcctat
cgcggtcccaaccagggcggcgaggccgggctcttcggctggcggcagatggattggctg
aaacgcgcgcttgccgcctcgcgcgccacctggaaggtgatcgcctgcgacatgcctatc
ggcctcgtcgtctgggacgactattcgaggaagcgcggctcggacgcgatcgccaatggc
gacaatggcgctcccggcggccgcgagacggaatttgccgatctcctgcgcttcatccgc
gacaatgcgatcgacaatatcgtctggctgacggcggacgtgcattacacggccgcgcat
cactacgatccgtcgcgcgccgccttcaaggatttcctgcccttctgggaattcgtctca
ggcccgctccactccggcacctatggcccgaaggaactcgacatgacctttgggccgcag
gtgcgcttcatcaaggcgtcggccggcggtatcgacagcaacctgccaccctcggccggc
ctgcaattcttcggcatcgtcgatatcaacggccagaccgagcagttgaccgtgcggctg
atggaccgccaggatcaggaactgtggcgcgtaacgctcgacccggcagccgtcgcttga

DBGET integrated database retrieval system