KEGG   Sinorhizobium fredii NGR234: NGR_c32100Help
Entry
NGR_c32100        CDS       T00888                                 

Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00860  Porphyrin and chlorophyll metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NGR_c32100
Enzymes [BR:rhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NGR_c32100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 7792480
NCBI-ProteinID: YP_002827696
RhizoBase: NGR_c32100
UniProt: C3MAF0
Position
complement(3371632..3372342)
Genome map
AA seq 236 aa AA seqDB search
MRVLVTRPRPAAERTARKLEAMGHTAIVLPLMQAQHFVAAVRAGFARPHDAIAVTSAEAV
RVLAGLGPDLQAHLATPFFAVGAATARVAADLGFRDIRVGAGTGEALAETVAGFLEPETG
SLLYFAGLPRADGFEHALRERGIDHVTVECYRMGAIDHAPETLPALVQSVPFDAVLLYSR
ETARRLVALIGESGLDCAGFSARYLCLSASVQDVLPTSAAADVAAAPDEDRLLGLL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcctcgtcacccgaccgcgacccgcagccgaaagaacggcgcggaagcttgag
gcgatgggacatacggcgatcgtcctgccgctgatgcaggcgcagcatttcgtcgccgcg
gtgcgcgccggcttcgcgcggccgcatgacgccattgccgtgaccagtgccgaggccgtc
cgtgttctggccgggctcggtcccgatcttcaggcgcatctggcgacaccgtttttcgcc
gtcggcgccgcgacggcgcgcgtcgccgccgatctcggcttcagggacatccgggtcggg
gccggaacgggcgaagcgctggcggagacggttgcgggcttcctcgagccggagaccgga
tcgctgctctatttcgccggcttgccgcgcgccgatggtttcgagcatgcgctgcgtgag
cgggggatagatcacgtcaccgtcgaatgctaccggatgggcgcgatcgaccacgcgccg
gaaacgctgcccgcccttgtgcagtccgtcccgttcgacgcggtgctgctgtattcgcgc
gagacggctcggcgcctcgtcgcgctcatcggcgaaagcggccttgattgcgccggcttt
tccgcacgttacctttgcctgagtgcgtccgtccaagatgtgctgcccaccagcgctgct
gccgacgttgcagcggcgcccgacgaggatcgcctgttgggcctcctttga

DBGET integrated database retrieval system