KEGG   Sinorhizobium fredii NGR234: NGR_c32460Help
Entry
NGR_c32460        CDS       T00888                                 

Definition
lipolytic protein, G-D-S-L family precursor
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    NGR_c32460
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NGR_c32460
   3.1.2  Thioester hydrolases
    3.1.2.-  
     NGR_c32460
Lipid biosynthesis proteins [BR:rhi01004]
 Fatty acid synthase
  Component type
   NGR_c32460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3405014..3405655
Genome map
AA seq 213 aa AA seqDB search
MRLKDFLPFFFCLAMTIVLSAPARAESVSLVGFGDSLMAGYQLPPGDAFPARLEKALKDK
GFDVTIANAGVSGDTTSSGLARIDWSVPGGTKGVILELGANDALRGIPPEETAKNLEAMI
LRLKERGVAVLLAGMMAPPNMGADYAARFNSIYSGLAREHNLAFYPFFLDGVVTKAGLQL
EDGMHPNGDGIAIMVERFLPTAEQFVRSLQKGE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcgattaaaagattttctgccctttttcttctgcctggcaatgacaatcgtgttatcg
gcgccggcccgtgccgaaagcgtgagtctcgtcggcttcggcgacagcctgatggccggc
tatcagcttccgccgggggatgcctttcccgcccggctcgaaaaggcgctcaaggacaag
ggttttgatgtcaccatcgccaatgcgggggtttcgggcgatacgacgtccagcggactt
gcccgcatagactggtcggtaccgggcgggacgaaaggcgtgattctcgagctcggcgcc
aatgacgcgctgcgcggcatcccgcccgaagaaaccgccaagaacctggaggcgatgatc
ctgcggctcaaggagcgcggtgtcgccgtgctgctggccggcatgatggcgccgccgaac
atgggcgccgactacgcggcccggttcaattcgatttattccggccttgcgagggaacac
aacctcgccttttaccctttcttcctcgacggcgtcgtgaccaaggcggggctgcaactc
gaagacggcatgcatccgaacggcgatggtatcgccataatggtggagcgctttcttccg
acggccgagcaattcgtccggtcgcttcagaaaggagagtga

DBGET integrated database retrieval system