KEGG   Sinorhizobium fredii NGR234: NGR_c33780Help
Entry
NGR_c33780        CDS       T00888                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGR_c33780 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGR_c33780 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NGR_c33780 (trpB)
Enzymes [BR:rhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NGR_c33780 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3567427..3568647
Genome map
AA seq 406 aa AA seqDB search
MNQPLKPNSFRAGPDEDGRFGIFGGRFVAETLMPLILDLQDEWNKAKNDPVFKAELEKLG
AHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGHGTLKD
AMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGQEAKEQLLAAEGRLPDLVV
AAVGGGSNAIGIFHPFLDDDGVRIVGVEAGGKGLDGDEHCASITAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHAWLNDIGRVEYVPIMDHEALEAFQTLTRLEGIIPA
LEPSHALAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVGKILGMGQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcagccgctaaaaccgaactccttcagggccggaccggatgaggacggccgtttc
ggtattttcggcggccgtttcgtcgccgagaccctgatgccgctgatccttgacctccag
gacgaatggaacaaggcaaagaatgacccggtgttcaaggcggagctcgagaagctcggc
gcccactatatcgggcgtccgagcccgctctatttcgccgagcgcctgacggccgagctc
ggcggcgcgaagatctatttcaagcgcgaggagctgaaccacaccggctcgcacaagatc
aacaattgcatcggccagatcctcttggccaagcgcatgggcaagacccgtatcattgcc
gagaccggcgccggccaacacggcgtggcttcggcaaccgtcgcggcccgcttcgggctt
ccctgcgtggtctacatgggcgccaccgacgtcgagcgccaggcgccgaacgtcttccgc
atgaagcttctcggcgccgaggtgaagccggtgaccgccggtcatgggacactgaaggac
gccatgaacgaggcgctgcgcgactgggtgacgaatgtcgacagcacctattacctgatc
ggcacggccgccggcccgcacccctatccggagatggtccgcgacttccaggcggtcatc
ggccaggaggccaaggaacagcttctcgcggccgagggccgcttgcccgacctcgtcgtt
gcggcggtcggcggcggctccaacgcgatcggcatcttccatcccttcctcgacgacgac
ggcgtcaggatcgtcggcgtcgaagcgggcggcaaggggctggacggcgacgagcactgt
gcctcgatcaccgccggctctccgggcgtgctgcacggcaaccgcacctacctgcttcag
gacggcgacggccagatcaaggaaggccactccatctcggccggtctcgattatccgggc
atcggtccggaacatgcctggctcaacgatatcggccgggtcgaatatgtgccgatcatg
gaccatgaggcgctcgaagccttccagacgttgacccgccttgaaggcatcatcccggcg
ctcgagccgtcgcatgcgctcgccgaggtcatcaagcgcgcgccgaaaatgggcaaggac
gagatcatcctgatgaatctctccggtcgcggcgacaaggacatcttcaccgtcggcaaa
attctgggaatggggcagtaa

DBGET integrated database retrieval system