KEGG   Sinorhizobium fredii NGR234: NGR_c33790Help
Entry
NGR_c33790        CDS       T00888                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00260  Glycine, serine and threonine metabolism
rhi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01130  Biosynthesis of antibiotics
rhi01230  Biosynthesis of amino acids
Module
rhi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGR_c33790 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NGR_c33790 (trpA)
Enzymes [BR:rhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NGR_c33790 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB TMP-TENI
Motif
Other DBs
NCBI-GeneID: 7792646
NCBI-ProteinID: YP_002827862
RhizoBase: NGR_c33790
UniProt: C3MBA0
Position
3568653..3569492
Genome map
AA seq 279 aa AA seqDB search
MTARMEQRFADVAAEGRPVLVTYFMGGDPDFETSLSIMQALPKAGADVIELGVPFSDPMA
DGPAIQLAGQRALKAGQTLAKTLELARRFRAEDQRTPIVLMGYYNPIYIYGVERFLNDAV
EAGVDGLIVVDLPPEMDDELCIPALKKGISFIRLATPTTDDRRLPKVLENTSGFVYYVSM
TGITGSALPDPSRIAGAVARIKSHTSLPVCVGFGVKTAEHARVIGASADGVVVGTAIVNQ
IASSLTEEGRVTEATVPGVEALVRGLSAGVRAARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggaacagaggttcgccgacgttgcggcagagggccgtccagttctt
gtcacttatttcatgggcggcgatcccgatttcgagacgtcgctttcgatcatgcaggcg
ctgccgaaggccggcgccgacgtgatcgagctcggcgttcccttttccgatccgatggcc
gacggcccggcgatccaactcgccggccagcgcgcgctcaaagccggacagacgcttgcc
aagacgctcgaactcgcccgccgcttccgggccgaggaccagcgcacccctatcgtgctg
atgggctactacaacccgatctatatctatggcgtcgagcggttcttgaacgatgccgtc
gaagccggcgtcgacgggctgatcgtcgtcgatctgccgccggaaatggacgacgagctg
tgcatcccggcgctcaagaagggcatcagcttcatccgcctggcaacgccaacgaccgac
gaccgccgcctgcccaaggttctcgaaaatacctccggtttcgtctattacgtctcgatg
accggcatcaccggttccgctctgcccgatccgtcgcggatcgccggtgcggtggcgcgg
atcaagtcgcacacgtcgctgcctgtctgcgtcggtttcggcgtcaagaccgccgagcat
gcgcgggtgatcggcgcctctgccgacggtgtcgtggtggggacggcgatcgtcaaccag
atcgcctcgagcttgacggaagaaggccgcgtcaccgaggcgacggtgccgggcgtcgag
gcgctggttcggggcctttcggccggggtgcgggcggcacgccttgcagcagccgaataa

DBGET integrated database retrieval system