KEGG   Sinorhizobium fredii NGR234: NGR_c33790Help
Entry
NGR_c33790        CDS       T00888                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGR_c33790 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGR_c33790 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NGR_c33790 (trpA)
Enzymes [BR:rhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NGR_c33790 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3568653..3569492
Genome map
AA seq 279 aa AA seqDB search
MTARMEQRFADVAAEGRPVLVTYFMGGDPDFETSLSIMQALPKAGADVIELGVPFSDPMA
DGPAIQLAGQRALKAGQTLAKTLELARRFRAEDQRTPIVLMGYYNPIYIYGVERFLNDAV
EAGVDGLIVVDLPPEMDDELCIPALKKGISFIRLATPTTDDRRLPKVLENTSGFVYYVSM
TGITGSALPDPSRIAGAVARIKSHTSLPVCVGFGVKTAEHARVIGASADGVVVGTAIVNQ
IASSLTEEGRVTEATVPGVEALVRGLSAGVRAARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggaacagaggttcgccgacgttgcggcagagggccgtccagttctt
gtcacttatttcatgggcggcgatcccgatttcgagacgtcgctttcgatcatgcaggcg
ctgccgaaggccggcgccgacgtgatcgagctcggcgttcccttttccgatccgatggcc
gacggcccggcgatccaactcgccggccagcgcgcgctcaaagccggacagacgcttgcc
aagacgctcgaactcgcccgccgcttccgggccgaggaccagcgcacccctatcgtgctg
atgggctactacaacccgatctatatctatggcgtcgagcggttcttgaacgatgccgtc
gaagccggcgtcgacgggctgatcgtcgtcgatctgccgccggaaatggacgacgagctg
tgcatcccggcgctcaagaagggcatcagcttcatccgcctggcaacgccaacgaccgac
gaccgccgcctgcccaaggttctcgaaaatacctccggtttcgtctattacgtctcgatg
accggcatcaccggttccgctctgcccgatccgtcgcggatcgccggtgcggtggcgcgg
atcaagtcgcacacgtcgctgcctgtctgcgtcggtttcggcgtcaagaccgccgagcat
gcgcgggtgatcggcgcctctgccgacggtgtcgtggtggggacggcgatcgtcaaccag
atcgcctcgagcttgacggaagaaggccgcgtcaccgaggcgacggtgccgggcgtcgag
gcgctggttcggggcctttcggccggggtgcgggcggcacgccttgcagcagccgaataa

DBGET integrated database retrieval system