KEGG   Sinorhizobium fredii NGR234: NGR_c34310Help
Entry
NGR_c34310        CDS       T00888                                 

Definition
phage-related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rhi  Sinorhizobium fredii NGR234
Brite
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     NGR_c34310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3631222..3632985)
Genome map
AA seq 587 aa AA seqDB search
MKTSLRGICAMLAEEAIVLAAYNDGTGTMTIGAGHTAAAGPPAPRAGATISLTEAINIYR
NDLAKTESQVQAAVRAVLSQHQFDALVSWHFNTGAVSSATLTRKLNAGDAAGAAAEFARW
NKSKGKVLEGLVARRERETAMFSKGDYGNPKIRVLESKSGPEEIFTADQIEALLSGAVSS
EDEQSTEELLANPISQLLPLHRPNQTIGVTKAVFQKFHDLIPEDGRDDAVAVVAVRGYYL
NTMGKEGANDRGVYDDAIFVLEPDGVHNFNGNTDPGRFARGIAKLKSHQAIRYRPGPHGF
SRKNGPYPAFRQDSNCTVIRDETGEDTDSPGGRFWINLHRGGITSTSSLGCQTVPPHQWN
EFKTLVDGLLKKHGQESFYYLLVDQDDVPQEETTVPAISQPAPTPAEVNPAQVLQQILTL
AAMLRGRTTPNQTDMVWLQDILRVLTADPIILNGEILNGKKPDPLVSTSDPQLTPVNGAL
GKTIGHALDGRKTAIGVVGMLATTVLPIFFPQLAPITAVAGTLIDGVANVSTTATQPGGG
LGRDLVTAAFPIFAAVAGWGTMGKVEKWVQALRSGLVAPAGSQSLIH
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacaagtctacgcggcatttgcgcaatgcttgccgaagaggcgatcgtgctcgcg
gcttacaacgacggcaccggcaccatgacgatcggcgccggccacaccgcggctgccggc
ccgccggctccccgcgccggcgcgacgatctcgctcaccgaggccatcaatatctaccgc
aacgacctcgccaagactgagagccaggtccaggcagcagtgagagccgtgctctcgcag
caccagttcgatgcgctcgtctcctggcacttcaacaccggcgcagtatcgagtgccacc
ttgacgcggaagctgaacgccggagacgcggccggcgctgcagccgagttcgcccgctgg
aacaagagcaagggcaaggtcctcgagggcctggtcgcccgccgcgagcgcgagacggcg
atgttctcgaaaggcgactatggcaatccgaaaatccgcgttctcgagagcaagagcggc
ccggaggagattttcactgccgaccagatcgaggcgctccttagcggcgcggtgagttcg
gaggacgagcagtccaccgaagagctgctcgcaaatccgatctcgcagcttctgccgctc
caccgccccaatcagaccatcggcgtcacaaaagccgtgttccagaagttccacgacctc
attcccgaggacggtcgcgacgatgcggtggcggtcgtggccgtgcgtggctattacctc
aacacaatgggcaaggagggggccaacgaccgcggcgtctatgatgatgccatcttcgtc
ctcgagcctgacggcgtccataacttcaacggcaataccgatcccggccggttcgcccgc
ggcatcgccaaattgaagtcgcaccaggcgatccggtatcgtccaggcccacacggattt
tcacgcaagaacggcccctatcccgcctttcgccaggacagcaactgcaccgtcatccgc
gacgagaccggtgaggatacggattcgcctggcggccgcttctggatcaatcttcaccgc
ggcggcatcacgtcgacctcgagcctcggctgccagaccgttccgccgcaccaatggaat
gaattcaagacgctggtggacggcctgctgaagaagcatggccaggagagcttctattac
ttgctcgtcgaccaagacgatgttccacaggaggaaacgaccgtgcccgccatatcgcag
cccgcgcctacgccggccgaggtcaaccccgcacaggtgctgcaacagattctgacgctc
gcagcaatgttgcgcgggcgcacgacgccgaatcagaccgacatggtctggttgcaggac
atcctgcgcgtgctcaccgccgatccgatcatactcaatggcgaaattctgaatggcaag
aaaccggacccactcgtctcgaccagcgacccccaactgacgccggtcaacggtgcgctc
ggcaagacgatcggccatgctctcgacggtcgaaagaccgcgatcggcgttgtcgggatg
ctcgccacaacagtcctgccgatattcttcccgcaattggcaccgataacggccgtcgcc
ggcacgctgatcgatggcgtggcaaacgtgagcaccacggcgacgcagcccggcggcggt
ctgggccgcgaccttgtaaccgctgcgttcccgatctttgctgccgtggcgggctggggg
acgatgggcaaagtcgagaagtgggtccaggccctgaggagcggacttgtcgctccggct
ggcagccaatccctgattcattag

DBGET integrated database retrieval system