KEGG   Sinorhizobium fredii NGR234: NGR_c34550Help
Entry
NGR_c34550        CDS       T00888                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NGR_c34550 (deoA)
Enzymes [BR:rhi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     NGR_c34550 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3663099..3664415
Genome map
AA seq 438 aa AA seqDB search
MALLPQEVIRKKRDGGRLDRAEIADFVSGLADGSISEGQVAAFAMATWFSGMNRDECVAL
TLAMRDSGDILDWSEFGRPIVDKHSTGGVGDNVSLMLAPIVAACGPNVPMISGRGLGHTG
GTLDKLESIPGYNIQPSPELFRQIVDEVGCAIIGQTANLAPADKRLYAIRDVTATVDSVP
LITASILSKKLAAGLQSLVLDVKLGNGSFMTDARATKTLARSLVDVANGAGVNTLALITD
MNEPLADAVGNALEVENCLAYLRGEKSGTRLDQVVMAFAAEMLVAARMAAHPAAGEAMAR
QALESGDAMERFALMVHRLGGPADFVDRSEAYLEKAPAVVIVPANRDGYLAACETRELGM
AVIALGGGRTRPDDRIDHRVGLAGLKPLGTKVERGEPIAFVHAADRQQAEAVRDRIAGFY
AIADERPASRPVIVSRIT
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcttccccaggaagtgatccggaagaagcgggacggcggtcggctcgaccga
gcggagatagccgacttcgtcagcggtctcgccgacggctcgatctcggaagggcaggtc
gccgccttcgccatggccacctggttctccggcatgaaccgcgacgaatgcgtggcgctg
acgctggcgatgcgcgattccggcgacatcctcgactggagcgagttcggccgccccatc
gtcgacaagcattcgaccggcggcgtcggcgacaatgtctcgctgatgctggcgccgatc
gtggccgcctgcggccccaacgtgccgatgatctccgggcgaggcctcggtcacaccggc
ggcacgctcgacaagctcgaatcgatcccgggctacaacatccagccgtcgcccgaactg
tttcgccagatcgtcgatgaggtcggctgcgccatcatcggccagaccgccaatctcgca
ccggccgacaagcgcctctacgcgatccgcgacgtgaccgcgacggtcgattcggtgccg
ctgatcaccgcgtcgatcctgtcgaaaaaactcgccgccgggcttcagtcgctggtgctg
gacgtcaagctcggcaatgggtccttcatgaccgatgcgcgagcgaccaagaccctggcg
cgctcgctcgtcgacgtcgcaaatggggcaggggtgaacaccttggcgctgatcaccgac
atgaacgagccgctcgcggacgcggtcggaaatgcgctggaagtcgagaactgccttgcc
tatctgcgcggcgaaaagtcgggaacccgcctcgaccaggtggtgatggctttcgcggcg
gaaatgctcgtcgcggcgaggatggcggcgcacccggctgcaggcgaagccatggctcgt
caagctctggagagtggcgacgcgatggaacgcttcgcccttatggtgcatcggctcggg
ggacccgccgatttcgtcgatcgatccgaagcctacctcgaaaaggcaccggccgtcgtc
atcgtgcctgccaaccgcgacggctatctcgccgcatgcgagacgcgtgagctggggatg
gccgtcattgcgctcggcggcgggcggacgcgaccggacgaccggatcgatcatcgggtg
ggacttgccggcctcaaaccgctggggacaaaggtcgagaggggcgaaccgatcgccttt
gtgcatgccgccgaccggcagcaggccgaagcggtgagagacaggattgccgggttctat
gcgattgccgacgagcggcccgcctcgcgccccgtgatcgtttcgagaattacctga

DBGET integrated database retrieval system