KEGG   Sinorhizobium fredii NGR234: NGR_c34850Help
Entry
NGR_c34850        CDS       T00888                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00010  Glycolysis / Gluconeogenesis
rhi00052  Galactose metabolism
rhi00500  Starch and sucrose metabolism
rhi00520  Amino sugar and nucleotide sugar metabolism
rhi00521  Streptomycin biosynthesis
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01200  Carbon metabolism
Module
rhi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_c34850 (glk)
   00052 Galactose metabolism
    NGR_c34850 (glk)
   00500 Starch and sucrose metabolism
    NGR_c34850 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NGR_c34850 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NGR_c34850 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NGR_c34850 (glk)
Enzymes [BR:rhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NGR_c34850 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-GeneID: 7792752
NCBI-ProteinID: YP_002827962
RhizoBase: NGR_c34850
UniProt: C3MBY4
Position
3695197..3696216
Genome map
AA seq 339 aa AA seqDB search
MPSASDHSFSFPILIGDIGGTNARFALLVDAASEPTQLPPVKTGDFATIEDALQNGIFNK
ISVRPRSAILAVAGPIKSDEIPLTNAGWVIRPKDMLARLGLEDVLVINDFEAQALAIAAP
ADQDVVQIGGGSVRPRSSRVVLGPGTGLGVAGLVFAQDTWIPVPGEGGHVDIGPRTERDF
RIWPFLDPIEGRMAGEQILCGRGIMNLYRAVCAADGVEPLFKDQAEVTTSALSGDDPAAI
ETVTLFATYLGRVAGDMALVFMARGGVFLAGGISQKILPALMRPDFRAAFEDKAPHSALM
RTIPTFAVVHPMAALSGLAAFARAPRDFGVAMEGRRWRS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtgcgagtgaccacagcttttcctttccgatcttgatcggcgatatcggcggg
acgaatgcccgtttcgcattgctcgtcgatgccgcttccgagccgacgcagcttccgccg
gtcaagaccggggatttcgcgacgatcgaggatgccctccagaacggcattttcaacaag
atctccgtccggccgcgttcggcgatccttgccgtggcggggccgatcaagagcgacgag
atcccgctgaccaatgccggctgggtgatccgcccgaaggacatgctggcgcggctcgga
ctggaagacgtgctggtcatcaacgatttcgaggcgcaggcgctcgccatcgccgcaccg
gccgatcaggacgtcgtgcagatcggcggcggcagcgtccggccgcgaagctcccgcgtg
gtgctcggccccggcaccgggctcggcgtcgccggattggtctttgcccaggacacctgg
attcccgtgccgggcgaaggcggtcatgtcgatatcggcccacgaaccgagcgcgacttc
cggatctggccgttcctcgatcccatcgagggccgcatggcgggcgagcagatcctgtgc
ggacgcggcatcatgaatctctaccgcgccgtctgcgcggccgatggcgtcgagccgctg
ttcaaggatcaggcggaggtgacgaccagcgctctctcgggcgacgatccggccgcaatc
gagacggtgacgctgttcgctacctatctgggacgtgttgccggcgacatggcgctggtc
ttcatggcccgcggcggcgtcttcctggccggggggatttcccagaagatattgccggcg
ctgatgagaccggacttccgcgccgccttcgaggacaaggcaccgcactctgcgctgatg
cggacgattccgactttcgcggtcgttcacccaatggcggcgctttccgggcttgccgcc
ttcgcacgggcgccgagggatttcggtgttgcaatggagggacggcgctggagaagctga

DBGET integrated database retrieval system