KEGG   Sinorhizobium fredii NGR234: NGR_c35160Help
Entry
NGR_c35160        CDS       T00888                                 

Gene name
cheB3
Definition
chemotaxis protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rhi02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rhi02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3730857..3731873)
Genome map
AA seq 338 aa AA seqDB search
MGHRDVIAIGGSMGAVGAMKHLLRGLPPDFPAVLFVVIHVGVRGNDLLADVLGHGAHLPV
TTAIDGERVQRGHVYVAPADHHLLVIDDVIHLGRGPRENLSRPAIDPLFRSVGAHYGPRA
IAVVLTGMLNDGAAGLADAKQCGSVTVVQNPSDAVASDMPIGALKASEVDYRAPLADLPA
LLCQLTREEAGLPVAIPPDITLEIDIALGRKIDSATLAEIADAVPLSCPACGGVLSQIKA
RPPLRFRCQVGHAYTSETLVADSEGAVDEAMRVALRIIEERVTLSEKMADDARRNGLGAA
AAANGRRAEEGRQHAETLRRAILGKSENAAAEKVEDAE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggccaccgcgacgtaatagccatcggggggtcgatgggagcggtcggtgcgatgaag
catctgcttcgcggtcttcctcccgactttcctgccgtcctttttgtcgtcatccatgtc
ggtgtgcgtggaaacgacctgctcgccgatgtcctcggccatggcgcccacctgcctgtc
accaccgcgatcgacggcgagcgcgttcaacgcggccacgtttatgttgcccccgcggac
caccatctgctcgtcatcgacgacgtcatccacctgggtcgtggcccacgcgaaaacctg
tcccggccagccatcgatccgctgttccgctctgtcggcgcacattacgggccgcgggca
atcgcggtcgttctgaccgggatgctgaatgacggggcggccggtctcgccgacgcaaag
caatgcggcagcgtgacggtcgtgcagaatccgagcgacgcggtcgcgtcggacatgccg
atcggcgctttgaaggccagcgaagtcgattatcgcgctccgctcgccgacctgccggcg
ctgctttgccagcttacgagggaggaggccggtctgccggtcgcgatccctcccgacatc
acgctggaaatcgacatcgccctcggtcgaaagatcgattcggccactctcgcggagatt
gccgatgccgtgccattatcgtgcccggcctgcggcggcgtactgtcacagatcaaggcc
cggccgccgctcaggttccggtgtcaggtcgggcatgcctatacgtccgagacactggtg
gccgactcggaaggcgctgtcgacgaggcgatgcgggtcgcgctccggatcatcgaagaa
agggtgactctcagcgaaaagatggcggacgatgcccgccgcaacggtctcggcgcggcg
gctgccgctaacggaagacgggccgaagaaggccgccagcatgccgaaactctgcgtcgc
gccattctcggcaagtccgaaaacgcggccgcggaaaaggtcgaggatgcggagtag

DBGET integrated database retrieval system