KEGG   Sinorhizobium fredii NGR234: NGR_c35180Help
Entry
NGR_c35180        CDS       T00888                                 

Definition
signal transduction histidine kinase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rhi02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rhi02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3733315..3735666
Genome map
AA seq 783 aa AA seqDB search
MRRELRDVVLFASHSLLRDPPFSHLDMISCRNLLIYLDRQLQQQVCSTFHYALNPGGVLF
LGSSESADHPAGLFRTVDREARIYRSVAGTGERRPALPVLLGPNQAAERAPVLARPQSLA
SSVSDAALHRQMLEKIAPPSMLIDESHRAIHLSENAGRFLRPSGGPVSTDATDLVREEFR
FDLRAALHRAFERNEATLSMPILAQLDGQPHRVYLQVKPVLQGSDPTRHALVLFIEGEAV
DKSAEMTSETLDGRPATNQTIRQLQEELQLAQNRLRVTREESEAANEELRAANEELQSMN
EEYRSTAEELETSKEELQSINEELQTVNNELKLKLESVSRAHSDLQNLMAATDVATLFLN
PSLRIKRLTPRLMEIFNVTMNDEGRPITDFTHQLEYEGLAEDADSVLEHLTPIEREVKSR
RDGWYLVRMRPYRTIDDKIDGVVVTFVDITERRHAEVAAKESAQRLDQETRLVELSRSPI
FVWDFDDGIKQWNRGSEELYGYSREEAVGKQKEDLLKTTVPGSSFEKLRQVLLEKGRWSG
ELHHTTKDGHVLTVESQIELVPLGDRRLVLESTRDVTDRKRWEKRRQLLVNELSHRVKNT
LAVVQSLARQTLRTTDSGEDFVERFDGRLAALAGAHKLLVESEWAGAELGALAFDQLRAY
SGGDPGRLQFEGDRVLLSPDIATPFGLVLHELATNAAKYGAFSTSNGQVGLRWKLGNNGR
RLTVTWTERGGPPVQPPGAQGFGGVLIEKSLPGAKVHRDFQPDGVVCTIDIELPEFPQNG
AES
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcgaactgcgtgacgtggtgctcttcgccagccacagcctgctgagagacccg
cccttctcgcatctcgacatgatttcctgccgcaacctgctgatctatctcgaccggcag
ctccagcagcaggtttgcagcaccttccactatgcgctcaatcctggcggcgtcctgttc
ctcggttcgtcggaaagcgccgaccatcccgcagggcttttccgcactgtggatcgcgag
gcgcgtatctacaggtccgtggcaggcaccggcgagcggcgcccggcgctgcccgtgctg
ctcggaccgaaccaggcagcggaaagggcaccggtgctcgcccggccgcaatcgctggcc
agcagcgtcagcgatgcggccctgcatcgccagatgctcgagaagatcgcgccgcctagc
atgctcatcgatgaaagccatcgggccatccatctttccgagaatgccggccgcttcctg
agaccctcgggcggcccggtcagcacggacgcgacggatctcgtgcgcgaggaatttcgc
ttcgacctgagggcggcactgcatcgcgccttcgagcgcaacgaggcaacgctgagcatg
ccgatcctcgcgcaactcgacgggcagccacaccgtgtctacttgcaagtcaaaccggtt
ctgcaggggagtgacccgacccgccacgcgctggtgctgttcatcgaaggcgaggcggtc
gacaagtcggcggagatgacctccgagacgcttgatgggcgccccgcgacgaaccagacc
attcggcaactgcaggaggaactgcaactcgcgcagaatcggcttcgggtgacgcgggaa
gagtcggaggccgccaacgaggaactgcgtgccgccaacgaggaactccagtcgatgaac
gaggaatatcgttcgacggcggaagagctcgaaacgagcaaggaggaattgcagtcgatc
aacgaggaactgcagaccgtcaacaacgagctcaagctgaagcttgaaagcgtgtcgcgc
gcccacagcgacctgcagaacctgatggccgcgaccgatgtcgcgacgctctttctcaac
ccttcgctgcgcatcaagcgcctcaccccgcgcctgatggaaatcttcaacgtcacgatg
aacgacgaggggcggccgatcaccgacttcacccaccaactcgaatatgagggtttggca
gaagacgcggattcggtcctggaacacctcacgccgatcgaacgggaggtgaagagccgt
cgtgacggctggtatctggtccgcatgcgtccctatcgcaccatagacgacaagatcgat
ggcgttgtggtgaccttcgtcgacattaccgagcgtcggcatgccgaggtggcggccaag
gaaagcgcacagcgcctcgaccaggaaacgcggctcgtggagctgtcgcgctcgccgatc
ttcgtctgggacttcgacgacggcatcaagcagtggaaccgcggcagcgaggagctctac
ggctattcgcgcgaggaagcggtcggaaagcagaaggaagacctgctcaagaccaccgtc
cccggttcttcgttcgagaaactcaggcaggtgctcctcgaaaagggccgctggagcggc
gaattgcaccacacgacgaaagacggccacgtgctgacggtcgagagccagatcgagctc
gtgccgctcggggatcggcgcctcgttctcgaaagcacgcgcgatgtcaccgaccgcaag
cgctgggagaagcgccggcaactcttggtcaacgagctcagccatcgggtaaagaatacg
cttgcggtcgtccagtcgctggcgcggcagacgctgcgcaccaccgattccggcgaggat
ttcgtcgagcgcttcgatggccgcctggcggcgctggcaggtgcccacaagctgcttgtc
gaatcggaatgggccggcgcggagcttggagccttggcgttcgaccagcttcgtgcctat
tccggcggcgacccggggcggctgcagttcgagggcgaccgggtcttgctgtctcccgac
atcgccacgcccttcggccttgttctccatgaacttgcgaccaatgcggcaaaatacggc
gcattctctacgtccaacggacaggttgggttgcgttggaaattggggaacaatgggagg
cgactgaccgttacttggacagagcgcggtggtccgccggtccagccgcccggggcgcag
ggcttcggcggcgtgctcatcgaaaagagcctgccgggggccaaggtgcatcgcgatttt
cagccggatggcgtcgtctgcacgatcgacatcgagcttccggagttcccgcaaaatgga
gcggaaagctaa

DBGET integrated database retrieval system