KEGG   Sinorhizobium fredii NGR234: NGR_c35500Help
Entry
NGR_c35500        CDS       T00888                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NGR_c35500
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NGR_c35500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3766767..3767447)
Genome map
AA seq 226 aa AA seqDB search
MNPYVNMGVGALLGTVFVLMTVSIASEGIFHSEAPEKEGFAIVAEEPTGEAGAGAGEEAK
PEPIGPLLAKADASAGEAVFKKCASCHTIEKGGPNKVGPNLWSVVNRPVASHEGFSYSAG
MKTFSEGGKVVWDYDHLSYFLEAPKKHVPGTAMGFAGLKKPDERANLLAWLREQADSPAP
LPAADATGATEAAPAAAPAEGQAATPTPAEGGQAAAPAAPAPAPAN
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatatgtgaacatgggtgtgggtgccttgctgggtacggtcttcgtgctgatg
accgtgtccattgcgtccgaaggcattttccattccgaagctcccgaaaaggaaggcttt
gcgatcgtcgccgaggaaccgacgggcgaagccggtgccggcgccggcgaagaagcaaag
ccggagccgatcggcccgctgctcgccaaggccgacgcgagcgccggcgaagccgtcttc
aagaaatgcgcaagctgtcacaccatcgagaagggcggaccgaacaaggtcggccccaat
ctctggagcgtcgtcaatcgcccggtcgcctcgcatgagggcttctcctactcggccggc
atgaaaaccttttccgaaggcggcaaggtcgtctgggactacgatcacctgagctacttc
ctcgaagcgccgaagaagcatgtgccgggcacggccatgggctttgccggcctgaagaag
ccggacgagcgcgccaacctgctcgcctggctgcgcgaacaggccgacagcccggcaccg
ctgcctgcggcggatgccaccggcgcgacggaagcagccccggctgccgcccctgccgaa
ggccaggccgccacgccaaccccggccgaaggcggtcaggcggcggcgcctgctgctccg
gctccggccccggcaaactaa

DBGET integrated database retrieval system