KEGG   Sinorhizobium fredii NGR234: NGR_c37140Help
Entry
NGR_c37140        CDS       T00888                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rhi03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3922701..3923591
Genome map
AA seq 296 aa AA seqDB search
MPELPEVETVKRGLAPAIEGALLVRAELRRPDLRFPFPENFAAAVSGRRILALSRRAKYL
MIDLEGGDVIVAHLGMSGSFRIEAGAQPAAPGEFHHPRGKDEKHDHVIFHLDGGSGQMRV
IYNDPRRFGFMDLARRDTIAEHAYFRDLGEEPTGNALDAAYLAARLAGKSQPLKTALLDQ
RTIAGLGNIYVCEALWRSGLSPNRAAGTLVDKRGRPKQALLALVEAIRAVIADAIAAGGS
SLKDHIQADGSLGYFQHAFSVYDRAGEACRKPGCDGTVTRIVQAGRSTFHCPRCQK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgcctgaggtcgagacggtcaaacgcggattggcgccggcgatagagggg
gcgctgctggtgcgcgccgaattgcggcggccggacctgcgctttccctttcccgagaat
ttcgccgccgccgtttcgggccgccgcatcctggcgttgtcgcggcgggccaagtatctg
atgatcgaccttgagggcggcgacgtgatcgtcgcgcatctcggcatgtccgggtcgttc
cgcatcgaggccggcgcgcagccggcggcacccggcgaattccaccatccgcgcggcaag
gacgagaagcacgaccatgtgatcttccatctcgacggagggtccggccagatgcgggtg
atctacaacgacccgcgccgcttcggtttcatggatctggcgcggcgcgacacgatcgca
gagcacgcctacttccgcgatctcggcgaggagccgaccggcaatgccctcgacgctgcc
tatctggctgcccgcctcgccgggaagtcgcagccgctgaagacggccctcctcgaccag
aggacgattgccggtctcggcaatatctatgtatgcgaggcgctgtggcgatccggcctg
tcgccgaacagggccgcaggcacgctggtcgacaagcgcggtcgtccgaaacaggccttg
ctcgcacttgtcgaggcgatccgcgcggtgattgccgacgcgatcgcggccggcggttcg
tcgctcaaggaccatatccaggcggatggcagcctcggctatttccagcatgccttctcc
gtctacgatcgggcgggcgaggcttgccgcaagccgggctgtgacggtacggtcacccgc
atcgttcaggcagggcgttcgaccttccattgcccgcgctgccagaaataa

DBGET integrated database retrieval system