KEGG   Rhizobium sp. LPU83: LPU83_0163Help
Entry
LPU83_0163        CDS       T03046                                 

Gene name
gabT
Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rhl  Rhizobium sp. LPU83
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LPU83_0163 (gabT)
   00650 Butanoate metabolism
    LPU83_0163 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LPU83_0163 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LPU83_0163 (gabT)
Enzymes [BR:rhl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LPU83_0163 (gabT)
Amino acid related enzymes [BR:rhl01007]
 Aminotransferase (transaminase)
  Class III
   LPU83_0163 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
162138..163415
Genome map
AA seq 425 aa AA seqDB search
MTATTLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYIDFAAGIAVLNTGHRHPR
VIAAVKDQLDHFTHTCHQVVPYESYVHLAERLNALTPGDFAKKTIFVTTGAEAVENAVKV
ARAATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHVPFPVELHGVTPE
QSLAALKKLFAADVDPQRVAAIIIEPVQGEGGFYAAPVSFMKALRELCDQHGILLIADEV
QTGFARTGKMFAMDHHEVAPDLMTMAKSLAGGFPLAAVTGRADIMDAPGPGGLGGTYGGN
PLGVAAAHAVLDVIKDEDLCNRANQLGSRLKQRLESLRERAPEIVDIRGPGFMNAVEFND
RTTKLPSPEFANKVRLTALEKGLILLTCGVHGNVIRFLAPITIQDSVFGEALDILEASIL
EASGK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaccacccttacagaccggaagaatgctgcaatttcccgcggcgtcggaatg
accacgcagatctatgccgatcgcgccgaaaacgccgagatctgggataaggaaggtcgc
cgctatatcgacttcgcggccggcatcgccgtcctcaataccggccatcgccatccgcga
gtgatcgctgccgtgaaggatcagctcgatcacttcacccacacctgccatcaggtcgtt
ccctatgagagctacgtgcatctggcggagcggctgaacgcgctgacgcccggcgatttc
gccaagaagacgatcttcgtcacaacaggtgccgaagccgtcgagaatgccgtgaaggtc
gcgcgggcggcgaccggccgttctgccgtcatcgccttcgggggcggctttcatggccgc
accttcatgggcatggctctcaccggcaaggtcgtgccttacaaggtcggtttcggcgcg
atgccgggcgatgtcttccatgtgccgttcccggtggagctccatggcgtaacgcctgag
caatcgcttgcagccttgaagaagctgtttgccgccgatgtcgatccgcaacgcgttgcc
gcaatcatcatcgagccggtgcagggcgagggtggcttctatgcggcgccggtttcgttc
atgaaggcactgcgcgaactctgcgaccagcacggcatcctcctgatcgccgatgaggtc
cagaccggctttgcgcgcaccggcaagatgttcgcgatggatcatcatgaggtcgcaccc
gacctgatgaccatggccaagagcctcgccggcggcttcccgctggcagccgtcaccggc
cgcgccgacatcatggatgcgccgggaccgggcggccttggcggcacctatggcggtaat
ccgcttggtgtcgccgctgctcacgcggttctcgatgtcatcaaggacgaagatctctgc
aaccgcgccaatcagcttggtagccgcttgaagcagcgtctggaatcgttgcgcgagagg
gcgcctgagatcgttgatatccgtggcccgggcttcatgaatgccgtcgaattcaacgac
agaacgacgaagctgccgagccccgaattcgccaacaaggtccgcctgaccgcgcttgag
aagggcctgatcctgctgacctgtggtgtccatggcaacgtcatccgcttccttgccccg
attaccatccaggacagtgtctttggtgaagcgctggacattctggaagcctcgatcctc
gaagcaagtggcaagtag

DBGET integrated database retrieval system