KEGG   Rhizobium sp. LPU83: LPU83_3947Help
Entry
LPU83_3947        CDS       T03046                                 

Definition
alkaline phosphatase D (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rhl  Rhizobium sp. LPU83
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rhl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LPU83_3947
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LPU83_3947
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LPU83_3947
Enzymes [BR:rhl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LPU83_3947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
Position
complement(3918597..3918893)
Genome map
AA seq 98 aa AA seqDB search
MIWDDYGHRRGSESISNGDNGAPLGRELEFADLLRFVRDACISNMVWLTADVHYTAAHSY
DPGKATFREFLPFWEFVAGPLHSGTYGPQQLDMTFGRR
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
gtgatctgggacgactacggacatcggcggggaagcgagtcaatctcgaacggcgacaat
ggcgcgccactcggtcgcgagctggagtttgccgacctgctgcggttcgtccgcgatgcc
tgcatatccaacatggtctggctgacggccgacgtgcactatacggcagcgcactcctac
gatcccggcaaggcgacgttccgcgagttcctcccgttctgggaattcgtggctggacct
ctccattccggaacctacggcccgcaacaactcgacatgaccttcggccgcaggtga

DBGET integrated database retrieval system